Recombinant Synechocystis sp. UPF0053 protein sll0260 (sll0260)

Shipped with Ice Packs
In Stock

Description

Functional and Biological Context

UPF0053 Protein Family

  • Sll0260 belongs to the UPF0053 family, a group of conserved bacterial proteins with poorly characterized roles. Homologs are implicated in membrane-associated processes, though no direct functional data exists for Sll0260 in Synechocystis .

Genetic and Genomic Associations

  • While sll0260 is not directly linked to PHB metabolism or photosynthesis in the provided studies, adjacent genomic regions in Synechocystis (e.g., slr0058slr0061 operon) encode proteins involved in polyhydroxybutyrate (PHB) synthesis and depolymerase activity . This suggests potential indirect metabolic connections, though no experimental evidence ties Sll0260 to these pathways.

Research Gaps and Future Directions

Current Limitations

  • No peer-reviewed studies in the provided sources explicitly investigate Sll0260’s biochemical activity, structural features, or physiological role.

  • The protein’s interaction partners and regulatory mechanisms remain uncharacterized.

Recommended Approaches for Future Studies

  1. Structural Analysis: NMR or X-ray crystallography to resolve 3D architecture.

  2. Knockout Studies: Phenotypic screening of Δsll0260 mutants under stress conditions (e.g., nutrient deprivation).

  3. Interaction Mapping: Co-fractionation or AP-MS to identify binding partners .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
sll0260; UPF0053 protein sll0260
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll0260
Target Protein Sequence
MFSSSVELELFFIFVLVVLNGIFSGSEIAIVSARKVRLEQLAKRGNRKAKLALKLATAPN NFLSAVQIGITLIGILTGAVGGATVALRLAEFLDDIPLLAPYAGPLSISLLVGFITYLSL VVGELVPKRIALSHPEHIACGVAPAMHLVAQLTAPLVYLLGVSTDAVLRLFGITSKEASP ITEEEIRVMIEQGAQAGMIDEAEQEMVERVFRLGDRPVKTLMTPRTAIAWLDVESDWEEN QQEILDTPYSRFPVGRDSLDECLGFVRVKDILNSQWSGQKINLEEIVQPPLFVAENTRSL HVLEMFRASGTHLALITDEYGGIEGLVTLNDLIEAIVGSIPNDDEIQEPQIIQREDGSYL LDGLLPIDEFKEIFDIETLSNEEEGHYHTLGGFVIESLGKIPQSGDYFVSDTLRVEVVDM DGIRIDKVLVNQLPEDSSTTEEESETDN
Uniprot No.

Target Background

Database Links
Protein Families
UPF0053 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0053 protein sll0260 from Synechocystis sp.?

The sll0260 protein is a member of the uncharacterized protein family UPF0053 found in the model cyanobacterium Synechocystis sp. PCC 6803. It consists of 448 amino acids and has a UniProt ID of P74409 . Synechocystis sp. PCC 6803 is widely used as a model organism for studying photosynthesis, energy metabolism, and environmental stress responses . The UPF0053 designation indicates that this protein belongs to a family of conserved proteins whose functions remain uncharacterized through conventional sequence analysis. Despite being part of the first fully sequenced phototrophic organism, sll0260 belongs to the approximately 50% of the Synechocystis proteome that still lacks definitive functional annotations .

How is recombinant sll0260 protein expressed and purified for research applications?

Recombinant sll0260 protein is typically expressed using an E. coli expression system with an N-terminal His-tag to facilitate purification . The methodological approach involves:

  • Cloning: The full-length coding sequence (1-448aa) is cloned into an appropriate expression vector containing an N-terminal His-tag.

  • Expression: Transformation into E. coli expression strains, followed by induction under optimized conditions.

  • Purification: Affinity chromatography using Ni-NTA or similar matrices that bind the His-tag.

  • Processing: The purified protein is typically obtained as a lyophilized powder after dialysis and freeze-drying procedures .

For optimal experimental outcomes, the reconstitution of the lyophilized protein should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for long-term storage, with 50% being the default concentration used by commercial suppliers .

What are the optimal storage conditions for recombinant sll0260 protein?

The optimal storage conditions for maintaining the stability and activity of recombinant sll0260 protein are:

  • Storage temperature: Store at -20°C/-80°C upon receipt .

  • Aliquoting: Divide into working aliquots to prevent repeated freeze-thaw cycles, which can significantly degrade protein quality and functionality.

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Buffer composition: The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

  • Reconstitution protocol: Prior to opening, vials should be briefly centrifuged to bring contents to the bottom. For reconstitution, deionized sterile water is recommended, followed by addition of glycerol for long-term storage .

Researchers should note that repeated freezing and thawing significantly reduces protein stability and functionality, making proper aliquoting an essential step in experimental design .

What computational methods can be used to predict the structure of sll0260?

Several computational approaches can be employed to predict the structure of uncharacterized proteins like sll0260:

  • Homology Modeling: This method is appropriate when templates with sequence similarity can be identified. For sll0260, potential templates could be identified using PSI-BLAST searches against the Protein Data Bank . Software packages like MODELLER, available through platforms such as Discovery Studio, can generate structural models based on template alignments .

  • Threading or Fold Recognition: When sequence similarity is insufficient for homology modeling, threading methods align the target sequence with known protein structures to identify similar folds. Servers like Sparksx, which uses SPINE X for predicting secondary structure, torsion angles, and solvent accessibility, are effective for this approach .

  • Ab Initio Modeling: For proteins with no detectable homology to known structures, ab initio methods can predict structure based solely on physicochemical principles. RaptorX is one such platform that uses the NEFF measurement to assess information content in sequence profiles .

  • Integrated Approaches: Combining multiple methods often yields more reliable predictions. Using PSI-BLAST and HHpred in conjunction with threading servers like Sparksx has proven effective for predicting structures of challenging targets .

For sll0260 specifically, a comprehensive approach would begin with PSI-BLAST searches to identify potential templates, followed by homology modeling if suitable templates exist, or threading/ab initio methods if no suitable templates are found.

How can the predicted structure be validated and refined?

Validation and refinement of predicted protein structures involve several methodological steps:

  • Ramachandran Plot Analysis: Evaluating the distribution of phi and psi angles to ensure they fall within allowed regions. Quality structures typically have >95% of residues in allowed regions .

  • ProFunc and Dali Server Analysis: These tools compare predicted structures against known structures to identify structural similarities that might indicate function. The analysis includes identification of signature sequences, ligand-binding templates, and DNA-binding templates .

  • Active Site Prediction: Computational tools can identify potential active sites or binding pockets in the predicted structure, which can guide experimental approaches for functional characterization .

  • Molecular Dynamics Simulations: Simulating the behavior of the protein in a physiologically relevant environment can refine the structure and provide insights into dynamic properties.

  • Z-score Assessment: Z-scores from structure comparison tools like Dali provide quantitative measures of structural similarity. Higher Z-scores (typically >10) indicate reliable structural matches .

For example, when applying similar approaches to other proteins, structures with 99% of residues in allowed regions of the Ramachandran plot have been successfully generated, leading to functional insights through the identification of binding sites and active cavities .

What experimental approaches can be used to determine the function of uncharacterized proteins like sll0260?

Multiple experimental approaches can be employed to elucidate the function of uncharacterized proteins like sll0260:

  • Protein-Protein Interaction Studies: Co-fractionation coupled with liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify interaction partners, providing clues about cellular pathways the protein participates in . For Synechocystis proteins, this approach has successfully identified 24,092 protein-protein interactions among 2,062 distinct gene products .

  • Gene Knockout/Knockdown: Creating mutant strains lacking the sll0260 gene can reveal phenotypic changes indicating the protein's function. This approach has been successful in revealing roles of other uncharacterized proteins in photosynthesis, metabolism, cell motility, and other physiological processes .

  • Localization Studies: Determining the subcellular localization using fluorescent protein tagging or immunolocalization can provide insights into the protein's functional context.

  • Comparative Genomics: Analyzing the conservation and co-evolution of sll0260 across species can reveal functional relationships. This approach has shown how protein functions vary from bacteria to higher plants due to changes in interaction partners .

  • Structural Analysis Combined with Functional Assays: Identifying structural similarities to characterized proteins can suggest potential functions that can then be tested experimentally. For example, proteins with similar structures to pseudouridine synthases can be tested for RNA modification activity .

The integration of multiple approaches typically provides the most comprehensive functional characterization, as demonstrated in studies that successfully annotated other conserved proteins .

How can proteomics approaches identify interaction partners of sll0260?

Proteomics approaches offer powerful methodologies for identifying interaction partners of uncharacterized proteins like sll0260:

  • Co-Immunoprecipitation (Co-IP) coupled with Mass Spectrometry: Using antibodies against the His-tagged recombinant sll0260 protein to pull down interaction partners, followed by mass spectrometry identification .

  • Tandem Affinity Purification (TAP): Expressing sll0260 with tandem affinity tags allows for sequential purification steps to isolate protein complexes with high specificity.

  • Protein Correlation Profiling: This approach involves fractionating cellular extracts and analyzing the co-elution patterns of proteins. Similar elution patterns suggest protein-protein interactions .

  • Cross-Linking Mass Spectrometry: Chemical cross-linking followed by mass spectrometry can capture transient interactions and provide spatial constraints for interacting proteins.

  • Protein Microarrays: Arrays containing purified Synechocystis proteins can be probed with labeled sll0260 to identify binding partners.

The effectiveness of these approaches is demonstrated by the comprehensive Synechocystis interactome study that defined 291 multi-protein complexes encompassing 24,092 protein-protein interactions among 2,062 distinct gene products . This type of analysis not only reveals direct interaction partners but also places proteins within functional networks, significantly advancing understanding of previously uncharacterized proteins.

How can site-directed mutagenesis be applied to study sll0260 function?

Site-directed mutagenesis represents a powerful approach for studying the function of sll0260 through systematic modification of specific amino acids:

  • Identification of Conserved Residues: Sequence alignment of sll0260 with homologs from other cyanobacteria and related organisms can identify evolutionarily conserved residues that may be functionally important. These conserved residues become primary targets for mutagenesis .

  • Structure-Guided Mutagenesis: If structural predictions identify potential active sites or binding pockets, residues within these regions can be targeted. For example, if sll0260 shows structural similarity to proteins with defined active sites containing aspartic acid and arginine residues (like Asp54 and Arg164 in pseudouridine synthases), these corresponding residues would be priority targets .

  • Mutagenesis Protocol:

    • Design primers containing the desired mutation

    • Perform PCR using a high-fidelity polymerase

    • Digest template DNA with DpnI

    • Transform into competent E. coli

    • Verify mutations by sequencing

    • Express and purify mutant proteins using the same protocol as wild-type

  • Functional Assays: Compare the biochemical properties of wild-type and mutant proteins through:

    • Activity assays (if a putative function is predicted)

    • Thermal stability measurements

    • Binding assays with potential substrates or interaction partners

    • Structural changes assessed by circular dichroism or fluorescence spectroscopy

  • In vivo Complementation: Introducing mutant variants into knockout strains to assess their ability to restore wild-type phenotypes provides insights into which residues are essential for function.

This approach has successfully identified catalytic residues in other proteins with initially unknown functions, such as pseudouridine synthases where mutations in conserved active site residues abolished enzymatic activity .

What analytical techniques can characterize the membrane association properties of sll0260?

Based on the amino acid sequence of sll0260, which contains hydrophobic regions suggestive of membrane association, several analytical techniques can characterize its membrane properties:

  • Subcellular Fractionation: Separation of Synechocystis cellular components (cytosolic, thylakoid membrane, plasma membrane fractions) followed by Western blot analysis to detect the presence of sll0260 .

  • Membrane Extraction Assays: Treating membrane fractions with reagents of increasing extraction strength (e.g., salt, carbonate, detergents) can determine the nature of membrane association (peripheral vs. integral).

  • Protease Protection Assays: Determining which regions of the protein are accessible to proteases in intact membrane vesicles can reveal the topology of membrane insertion.

  • Fluorescence Microscopy: Expression of sll0260 fused to fluorescent proteins can visualize its localization within the cell, particularly in relation to membrane structures.

  • Liposome Binding Assays: In vitro reconstitution experiments using purified recombinant sll0260 and artificial liposomes of defined composition can assess direct membrane binding capability and lipid preferences.

  • Circular Dichroism (CD) Spectroscopy: Comparing CD spectra of sll0260 in aqueous solution versus membrane-mimetic environments (detergent micelles, liposomes) can reveal structural changes upon membrane interaction.

These approaches can determine whether sll0260 functions as a membrane protein, which would be consistent with many proteins in photosynthetic organisms that participate in photosynthesis, energy metabolism, and environmental stress responses .

How does sll0260 fit into the broader context of Synechocystis proteome research?

The study of sll0260 should be contextualized within the broader Synechocystis proteome research landscape:

  • Genome Annotation Status: Despite Synechocystis being the first fully sequenced phototrophic organism, approximately half of its proteome still lacks functional annotations . sll0260 is part of this uncharacterized portion, representing the ongoing challenge in cyanobacterial genomics.

  • Protein Complex Networks: Comprehensive studies have defined 291 multi-protein complexes in Synechocystis, encompassing 24,092 protein-protein interactions among 2,062 distinct gene products . Determining where sll0260 fits within this network is crucial for understanding its functional context.

  • Functional Category Integration: Synechocystis proteins participate in diverse processes including photosynthesis, metabolism, cell motility, DNA repair, and cell division . Identifying which of these processes involves sll0260 requires integration of multiple data types.

  • Comparative Proteomics: Studies of how protein functions vary from bacteria to higher plants due to changes in interaction partners can provide evolutionary context for sll0260 function .

  • Proteomics Methodologies: Various proteomics approaches have been applied to Synechocystis, including different protein and peptide separation methods that have identified different subsets of the proteome . The table below summarizes the protein identification results from different proteomics methods:

Protein separationPeptide separationTotal MS samplesTotal unique peptidesTotal unique proteins
NoNo13615
NoSCX401900571
NoIEF25634321
NoSCX25612335
1DSCX25497*

*Value not fully provided in source data

What biochemical and biophysical techniques are most informative for characterizing sll0260?

A comprehensive characterization of sll0260 requires multiple complementary biochemical and biophysical techniques:

  • X-ray Crystallography or Cryo-EM: These techniques can provide high-resolution structural information, revealing detailed molecular architecture beyond computational predictions. While computational methods like homology modeling and threading are valuable starting points , experimental structure determination remains the gold standard.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can map regions of structural flexibility and identify potential binding interfaces by measuring the rate of hydrogen exchange with deuterium across the protein.

  • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC): These methods can quantitatively characterize binding interactions with potential substrates, cofactors, or protein partners, providing both kinetic and thermodynamic parameters.

  • Circular Dichroism (CD) and Fourier-Transform Infrared Spectroscopy (FTIR): These spectroscopic techniques provide information about secondary structure content and can monitor structural changes upon ligand binding or environmental perturbation.

  • Differential Scanning Fluorimetry (DSF) or Differential Scanning Calorimetry (DSC): These approaches measure protein thermal stability and can identify conditions or ligands that stabilize the protein structure.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For proteins under 25-30 kDa or isolated domains, NMR can provide not only structural information but also insights into dynamics and interactions in solution.

The integration of these techniques with the proteomics and genomics approaches discussed earlier provides a multi-dimensional characterization strategy that has successfully elucidated the functions of other initially uncharacterized proteins in various systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.