Recombinant Synechocystis sp. UPF0187 protein sll1024 (sll1024)

Shipped with Ice Packs
In Stock

Description

Overview of the Recombinant Protein

The recombinant Synechocystis sp. UPF0187 protein sll1024 (UniProt ID: P72926) is a bioengineered form of the native sll1024 gene product from Synechocystis sp. PCC 6803. This protein belongs to the UPF0187 family, a class of uncharacterized proteins with conserved sequences across cyanobacteria but no well-established functional annotations .

PropertyValue
Gene Namesll1024
UniProt IDP72926
Expression HostE. coli
Tag TypeUndisclosed (determined during production)
Protein Length1–307 amino acids
Purity>90% (SDS-PAGE)
Storage BufferTris-based, 50% glycerol, pH optimized
Storage Conditions-20°C/-80°C (long-term); 4°C (working aliquots)

Potential Applications and Research Gaps

While no specific studies on sll1024’s function are cited in available literature, UPF0187 proteins are often candidates for:

  • Structural Studies: Resolving the 3D structure to infer evolutionary conservation or functional motifs.

  • Interaction Mapping: Identifying binding partners via yeast two-hybrid or affinity pull-down assays .

  • Metabolic Engineering: Leveraging its cyanobacterial origin for biotechnological applications (e.g., biosynthesis pathways) .

Limitations:

  • Functional Annotation: No direct evidence links sll1024 to metabolic pathways, stress responses, or regulatory networks.

  • Experimental Data: Absence of biochemical assays (e.g., kinase/phosphatase activity, ligand binding) in public repositories .

Comparative Analysis with Related Proteins

UPF0187 proteins in Synechocystis share low sequence similarity to characterized enzymes, distinguishing them from well-studied proteins like:

ProteinFunctionSourceReference
SLL0260UPF0053 protein (unknown function)Synechocystis
Slr0058PHB granule formationSynechocystis
SynPPP1 (sll1387)Protein phosphatase (PPP family)Synechocystis

Future Research Directions

  1. Functional Screens: High-throughput assays to identify sll1024’s role in cyanobacterial metabolism.

  2. Evolutionary Analysis: Phylogenetic studies to trace UPF0187 distribution across cyanobacteria.

  3. Biotechnological Utility: Assessing sll1024’s compatibility with heterologous expression systems for scalable production .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
sll1024; UPF0187 protein sll1024
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll1024
Target Protein Sequence
MSFFSHHPSRSPRIWTDILLRWQGSVIPAIASRVLVCMAFSLGVTLVDGWGYKFSIPIQE SIVPSIVLGLLLVFRTNTAYERFWEGRKAWGTMVNTIRNLSRIIWVSVAEPSPQAHQDKI KILHLLVAFAVATKLHLRSQPLNEEIWALLPESGYRKLEDLNNPPLEIAFWISNYLQREY DQNNINAYQLTAMLRLVDTMVDVLGSCERILKTPIPLAYAIHLRQLIFLYCFITPFQIVN TLHWATAFVVGIIAFTVFGIEEIGVEIENPFGHDANDLPLDQICQTMQANLEDLIQLPPW HQISHGD
Uniprot No.

Target Background

Database Links
Protein Families
UPF0187 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for the recombinant sll1024 protein?

The optimal storage conditions for recombinant sll1024 protein involve storing the purified protein at -20°C or -80°C in appropriate buffer systems. The recommended storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0. For long-term storage, it is advisable to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquot the protein solution to avoid repeated freeze-thaw cycles, which can compromise protein stability and activity .

For working with the protein, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein integrity .

How is the purity of recombinant sll1024 protein typically assessed?

The purity of recombinant sll1024 protein is typically assessed using SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis). This technique separates proteins based on their molecular weight, allowing researchers to visualize the purified protein as a distinct band. Commercial preparations generally ensure a purity greater than 90% as determined by SDS-PAGE .

For more precise analysis, researchers may employ additional techniques:

MethodApplicationResolutionAdditional Information
SDS-PAGEBasic purity assessmentMediumStandard for protein visualization
Western BlotSpecific protein identificationHighUses antibodies against His-tag or protein
Mass SpectrometryExact mass determinationVery HighCan confirm protein identity and modifications
Size Exclusion ChromatographyOligomeric state assessmentHighDetermines aggregation state

Each method provides complementary information about protein purity and integrity, with the combination of techniques offering the most comprehensive assessment.

What are the recommended protocols for efficient expression of recombinant sll1024 in E. coli?

For efficient expression of recombinant sll1024 in E. coli, researchers should consider a methodological approach similar to that used for other cyanobacterial proteins. Based on protocols developed for Synechocystis proteins, the following steps are recommended:

  • Vector Selection: Choose an expression vector with an N-terminal His-tag that works well in E. coli systems, such as pET series vectors.

  • Codon Optimization: Consider codon optimization for E. coli expression, as cyanobacterial codon usage can differ from E. coli.

  • Bacterial Strain Selection: BL21(DE3) or Rosetta(DE3) strains are commonly used for expressing cyanobacterial proteins due to their reduced protease activity and, in the case of Rosetta, supplementation with rare codons.

  • Culture Conditions:

    • Grow cultures at 37°C until OD600 reaches 0.6-0.8

    • Induce with IPTG (typically 0.5-1.0 mM)

    • Lower the temperature to 18-25°C post-induction

    • Continue expression for 16-20 hours

  • Lysis Buffer Composition:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10 mM imidazole

    • 1 mM PMSF (protease inhibitor)

    • Optional: 5% glycerol to enhance stability

The natural transformation methods used for Synechocystis (as described in search result ) can provide insights into gene manipulation, though these are specific to the cyanobacterium rather than E. coli expression systems .

What purification strategies are most effective for isolating recombinant sll1024 protein?

The most effective purification strategy for isolating recombinant sll1024 protein with an N-terminal His-tag involves immobilized metal affinity chromatography (IMAC), followed by additional purification steps if higher purity is required:

  • IMAC Purification (Primary Step):

    • Ni-NTA or Co-NTA agarose columns are commonly used

    • Equilibration buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Wash buffer: Same as equilibration but with 20-30 mM imidazole

    • Elution buffer: Same base buffer with 250-300 mM imidazole

    • Collect fractions and analyze by SDS-PAGE

  • Size Exclusion Chromatography (Secondary Step):

    • Using columns such as Superdex 75 or 200

    • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl

    • Flow rate: 0.5-1.0 mL/min

  • Buffer Exchange and Concentration:

    • Use centrifugal filters with appropriate molecular weight cut-off

    • Exchange into storage buffer (Tris/PBS-based buffer with 6% trehalose, pH 8.0)

    • Add glycerol to desired final concentration (5-50%)

This purification approach has been successful for similar cyanobacterial proteins and should be effective for sll1024 as well .

How can researchers verify the functional activity of purified sll1024 protein?

  • Structural Integrity Assessment:

    • Circular Dichroism (CD) spectroscopy to confirm proper folding

    • Thermal shift assays to evaluate protein stability

    • Dynamic Light Scattering (DLS) to assess aggregation states

  • Binding Assays:

    • If potential binding partners are hypothesized, pull-down assays can be performed

    • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) for quantitative binding measurements

  • Enzymatic Activity Testing:

    • Based on bioinformatic predictions of function, design appropriate enzymatic assays

    • For proteins with unknown function, test for common activities (phosphatase, kinase, etc.)

  • In Vivo Complementation:

    • Create knockout strains in Synechocystis using homologous recombination techniques similar to those described for other genes

    • Test if the recombinant protein can restore wild-type phenotype

For example, researchers studying other Synechocystis proteins have used gene knockout techniques followed by phenotypic characterization to understand protein function. The methodology for creating knockout strains involves homologous recombination with resistance cassettes, as demonstrated in studies of other proteins such as SyOC and Kai proteins .

How does sll1024 potentially interact with other proteins in Synechocystis sp. PCC 6803 metabolic pathways?

The potential interactions of sll1024 with other proteins in Synechocystis sp. PCC 6803 metabolic pathways require advanced investigation methods. While specific interaction data for sll1024 is limited in the provided search results, researchers can employ the following approaches:

  • Bioinformatic Analysis:

    • Sequence-based predictions of protein-protein interactions

    • Structural modeling to identify potential interaction domains

    • Comparative analysis with homologous proteins in related organisms

  • Experimental Interaction Studies:

    • Co-immunoprecipitation (Co-IP) using antibodies against the His-tag

    • Bacterial two-hybrid (B2H) or yeast two-hybrid (Y2H) screens

    • Protein crosslinking followed by mass spectrometry analysis

  • Functional Genomics Approaches:

    • Construct deletion mutants similar to methods used for other Synechocystis genes

    • Perform transcriptomic and proteomic analyses to identify altered pathways

    • Metabolomic profiling to identify changes in metabolite levels

  • Localization Studies:

    • Fluorescent protein tagging to determine subcellular localization

    • Co-localization experiments with known pathway components

Given that researchers have successfully studied other Synechocystis proteins using knockout approaches and competitive fitness assays , similar methodologies could be applied to understand sll1024's role in metabolic pathways.

What role might sll1024 play in oxidative stress response mechanisms in Synechocystis?

While the specific role of sll1024 in oxidative stress response is not directly addressed in the provided search results, researchers can design experiments to investigate this possibility based on approaches used for other Synechocystis proteins:

  • Oxidative Stress Exposure Experiments:

    • Subject wild-type and sll1024 knockout strains to various oxidative stressors (H₂O₂, paraquat, high light)

    • Measure survival rates, growth curves, and physiological parameters

    • Monitor photosynthetic efficiency using PAM fluorometry

  • Molecular Response Analysis:

    • Examine transcriptional changes of known oxidative stress genes in sll1024 mutants

    • Measure reactive oxygen species (ROS) levels using fluorescent probes

    • Assess antioxidant enzyme activities (catalase, peroxidase, SOD)

  • Protein Modification Analysis:

    • Investigate potential redox-sensitive residues in sll1024

    • Examine post-translational modifications under stress conditions

    • Assess protein stability and turnover during oxidative stress

  • Comparative Analysis with Known Stress Proteins:

    • Draw parallels with other proteins involved in oxidative stress, such as SyOC

    • Examine potential interactions with known stress response pathways

Research on the pseudo-orthocaspase (SyOC) in Synechocystis has demonstrated involvement in oxidative stress responses , providing a methodological framework that could be adapted for studying sll1024's potential role in similar processes.

What techniques are most suitable for investigating the structure-function relationship of sll1024?

Investigating the structure-function relationship of sll1024 requires a multi-faceted approach combining structural biology techniques with functional analyses:

  • Structural Determination Methods:

    TechniqueResolutionInformation ProvidedLimitations
    X-ray CrystallographyVery High (1-3Å)Atomic-level structureRequires protein crystals
    NMR SpectroscopyHigh (3-5Å)Solution structure, dynamicsSize limitations (~30 kDa)
    Cryo-EMMedium-High (3-4Å)Structure without crystalsEquipment accessibility
    CD SpectroscopyLowSecondary structure contentLimited structural details
  • Site-Directed Mutagenesis Strategy:

    • Identify conserved residues through sequence alignment

    • Generate point mutations at these sites

    • Express and purify mutant proteins

    • Compare biochemical properties with wild-type protein

  • Domain Analysis and Truncation Studies:

    • Create constructs expressing specific protein domains

    • Assess function of individual domains

    • Investigate domain interactions

  • Molecular Dynamics Simulations:

    • Use structural data for computational simulations

    • Predict conformational changes and dynamics

    • Identify potential functional sites and mechanisms

Researchers studying other Synechocystis proteins have successfully employed targeted mutagenesis approaches, as seen in the study of SynPPM3 where replacement of Asp608 with asparagine enhanced activity toward phosphotyrosine-containing proteins . This demonstrates the value of structure-guided mutagenesis in understanding protein function.

What are common challenges in expressing and purifying recombinant sll1024, and how can they be addressed?

Researchers working with recombinant sll1024 may encounter several challenges during expression and purification. Here are common issues and their solutions:

  • Low Expression Levels:

    • Optimize codon usage for E. coli

    • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Vary induction conditions (IPTG concentration, temperature, duration)

    • Consider using stronger promoters or specialized expression vectors

  • Protein Insolubility/Inclusion Bodies:

    • Lower induction temperature (16-20°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Add solubility enhancers to media (sorbitol, glycine betaine)

    • Use fusion partners known to enhance solubility (SUMO, MBP, TrxA)

    • If inclusion bodies persist, develop refolding protocols

  • Protein Instability:

    • Include protease inhibitors in all buffers

    • Maintain cold temperatures throughout purification

    • Add stabilizing agents (glycerol, trehalose as used in the standard storage buffer )

    • Optimize buffer conditions (pH, salt concentration)

  • Purification Difficulties:

    • For poor His-tag binding: adjust imidazole concentrations

    • For co-purifying contaminants: add additional purification steps (ion exchange, size exclusion)

    • For protein aggregation: add mild detergents or optimize buffer composition

The natural transformation methods developed for genetic manipulation of Synechocystis provide insights into the biology of this organism, which may help inform expression strategies for its proteins.

How can researchers troubleshoot inconsistent results in functional assays involving recombinant sll1024?

Inconsistent results in functional assays involving recombinant sll1024 can stem from various sources. Here's a systematic approach to troubleshooting:

  • Protein Quality Assessment:

    • Verify protein purity by SDS-PAGE and other methods

    • Check for degradation using western blot

    • Assess protein folding using CD spectroscopy

    • Determine aggregation state using size exclusion chromatography or DLS

  • Assay Optimization Matrix:

    ParameterVariables to TestMonitoring Method
    Buffer CompositionpH (6.5-8.5), Salt (50-500 mM)Activity measurements
    TemperatureRange from 4-37°CThermal stability assay
    CofactorsMetal ions, potential binding partnersEnhanced activity
    Protein ConcentrationSerial dilutionsLinearity of response
  • Controls and Standards:

    • Include positive and negative controls in each assay

    • Prepare standards with known activity levels

    • Use freshly prepared reagents and buffers

    • Standardize protocols between experiments

  • Equipment and Technical Variables:

    • Calibrate instruments regularly

    • Control for environmental factors (temperature, humidity)

    • Minimize operator variability through detailed protocols

    • Consider automated systems for greater consistency

The approach used to study protein phosphatases in Synechocystis, where researchers tested enzyme activity under various conditions and with different substrates , exemplifies how systematic optimization can lead to reliable functional assays.

What are the potential pitfalls in comparative analysis between wild-type and recombinant sll1024 protein?

When conducting comparative analyses between wild-type and recombinant sll1024 protein, researchers should be aware of several potential pitfalls:

  • Expression System Differences:

    • Recombinant protein is expressed in E. coli versus native expression in Synechocystis

    • Differences in protein folding machinery between organisms

    • Potential absence of Synechocystis-specific chaperones in E. coli

    • Solution: Consider parallel studies in native and recombinant systems

  • Post-translational Modifications:

    • E. coli may not reproduce the same PTMs present in Synechocystis

    • Potential phosphorylation, glycosylation, or other modifications missing

    • Solution: Analyze PTMs in native protein and develop E. coli strains capable of similar modifications if critical

  • Tag Interference:

    • The N-terminal His-tag may affect protein function or interactions

    • Solution: Compare tagged and tag-cleaved versions or use alternative tag positions

  • Functional Context:

    • Isolated protein may behave differently than in its native cellular environment

    • Solution: Develop in vitro systems that mimic the cellular environment or complement with in vivo studies

  • Quantitative Comparison Challenges:

    AspectPotential IssueMitigation Strategy
    Protein AmountDifferent quantification methodsUse multiple quantification methods
    Activity MeasurementDifferent assay conditionsStandardize conditions rigorously
    Structural IntegrityDifferent analytical techniquesApply identical techniques to both forms
    Interaction PartnersAbsence in recombinant systemAdd potential partners to in vitro assays

Studies of other Synechocystis proteins have addressed these issues by combining recombinant protein characterization with in vivo studies using gene knockouts and complementation , providing a holistic understanding of protein function.

How might CRISPR-Cas9 technology be applied to study sll1024 function in Synechocystis sp. PCC 6803?

CRISPR-Cas9 technology offers promising approaches for studying sll1024 function in Synechocystis sp. PCC 6803, potentially improving upon traditional homologous recombination methods:

  • Precise Gene Editing Applications:

    • Generate clean knockouts without antibiotic resistance markers

    • Create point mutations to study specific amino acid functions

    • Develop conditional knockdowns using inducible CRISPR systems

    • Engineer tagged versions of sll1024 at the native locus

  • Methodological Implementation:

    • Design sgRNAs targeting specific regions of sll1024

    • Introduce Cas9 and sgRNA expression constructs via natural transformation

    • Provide repair templates for precise editing

    • Screen transformants using PCR and sequencing

  • Multiplexed Gene Editing:

    • Simultaneously target sll1024 and potential interacting partners

    • Create multiple mutations to study genetic interactions

    • Engineer regulatory elements to modulate expression levels

  • Technical Considerations:

    ComponentOptimization FactorImplementation Strategy
    sgRNA DesignPAM site availability, off-target effectsUse prediction tools specific for cyanobacteria
    Cas9 ExpressionToxicity, expression levelsUse inducible or transient expression systems
    TransformationEfficiency, selectionModify natural transformation protocols
    ScreeningDetection of editsDevelop high-throughput phenotypic screens

While traditional homologous recombination methods have been successful in Synechocystis , CRISPR-Cas9 could offer advantages in efficiency and precision, particularly for creating subtle mutations that might reveal specific functional aspects of sll1024.

What approaches can be used to investigate sll1024's potential role in circadian rhythms or metabolic adaptation?

Investigating sll1024's potential role in circadian rhythms or metabolic adaptation requires integrative approaches that build upon methods used to study other Synechocystis proteins:

  • Circadian Rhythm Investigation:

    • Generate luciferase reporter strains similar to those used for Kai proteins

    • Monitor expression patterns of sll1024 over 24-hour cycles

    • Create knockout strains and assess rhythm disruption

    • Perform competition experiments under different light/dark cycles to assess fitness effects

  • Metabolic Adaptation Studies:

    • Utilize the high-throughput culturing platform developed for metabolic response studies

    • Test growth of sll1024 mutants under various nutrient conditions

    • Analyze exometabolome profiles using the techniques described for nutrient response studies

    • Measure photosynthetic parameters under different conditions

  • Integration with Known Regulatory Networks:

    • Examine interactions with known circadian regulators (Kai proteins)

    • Investigate relationships with metabolic control proteins

    • Study transcriptional responses to environmental changes

  • Advanced Analytical Approaches:

    • Time-series transcriptomics and proteomics

    • Metabolic flux analysis using isotope labeling

    • Single-cell analyses to detect population heterogeneity

The methodologies used to study circadian rhythms in Synechocystis, including the creation of luminescence reporter strains and competitive fitness assays under different light conditions , provide excellent templates for investigating sll1024's potential role in these processes.

How can systems biology approaches enhance our understanding of sll1024 in the context of cyanobacterial cellular networks?

Systems biology approaches can significantly enhance our understanding of sll1024 within the broader context of cyanobacterial cellular networks:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify correlations between sll1024 expression and other cellular components

    • Map sll1024 onto known metabolic and signaling networks

    • Develop predictive models of sll1024 function

  • Network Analysis Methods:

    • Construct protein-protein interaction networks

    • Perform gene co-expression analysis under various conditions

    • Apply graph theory to identify network motifs and modules

    • Use machine learning to predict functional relationships

  • Genome-Scale Modeling:

    • Incorporate sll1024 into genome-scale metabolic models

    • Simulate knockouts and overexpression effects on metabolic flux

    • Predict phenotypic outcomes under different environmental conditions

    • Validate model predictions with experimental data

  • Comparative Systems Analysis:

    ApproachApplication to sll1024Expected Outcome
    Cross-species comparisonIdentify functional orthologs in other cyanobacteriaEvolutionary insights
    Condition-specific networksMap sll1024 in stress vs. normal conditionsContext-dependent roles
    Temporal network dynamicsTrack network changes over diurnal cyclesCircadian regulation insights
    Spatial organizationLocalize sll1024 within subcellular compartmentsFunctional context

The high-throughput methods developed for studying metabolic responses in Synechocystis and the genetic manipulation techniques established for studying various proteins provide a foundation for implementing these systems biology approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.