Recombinant Synechocystis sp. UPF0754 thylakoid membrane protein sll0412 (sll0412)

Shipped with Ice Packs
In Stock

Description

General Information

Sll0412 is a protein found in the thylakoid membranes of Synechocystis sp. PCC 6803 . Thylakoid membranes are the site of the light-dependent reactions of photosynthesis. Sll0412's specific function is not yet fully understood, but research suggests its involvement in the assembly and repair of Photosystem II (PSII) .

Role in Photosystem II

PSII is a protein complex essential for oxygenic photosynthesis . Studies indicate that Sll0412 interacts with other proteins involved in PSII assembly and repair . Specifically, it shows a close functional relationship with Sll0933, a protein that interacts with Ycf48 during PSII assembly and is homologous to PAM68 in Arabidopsis thaliana . Mutants lacking Slr0151, another protein involved in PSII repair, exhibit altered levels and localization of Sll0412 .

Localization and Distribution

Immunofluorescence analysis has revealed a punctate distribution of Slr0151 (a protein with functional links to Sll0412) within different membrane types in Synechocystis cells . Subcellular fractionation experiments have detected Slr0151 in both the plasma membrane (PM) and thylakoid membranes (TMs) . Further fractionation of thylakoids showed that Slr0151 is present in both PratA-defined biogenic membranes (PDMs) and photosynthetically active thylakoids, suggesting a broad distribution throughout the cell .

Genetic Manipulation and Mutant Studies

Researchers employ techniques such as homologous recombination and CRISPR interference (CRISPRi) to study gene function in Synechocystis . These methods allow for the creation of knockout mutants or the repression of gene expression to assess the impact on various cellular processes . The study of Sll0412 often involves creating mutants to observe the resulting phenotypic changes, which can provide insights into its function.

Interactions with Other Proteins

Sll0412, specifically Slr0151, interacts with Sll0933, which is involved with PSII assembly . Additionally, hypothetical proteins Sll0445, Sll0446, and Sll0447 have been found to form a stable association with pilus assembly proteins Slr2015 and Slr2018, as well as with photosystem complexes .

Biotechnological Applications of Synechocystis

Beyond the fundamental understanding of cellular processes, Synechocystis is explored for biotechnological applications such as the production of terpenes and biofuels . Genetic engineering strategies are employed to enhance the production of these compounds . For example, Synechocystis has been engineered for the photosynthetic production of high-value terpenes such as farnesene and santalene . Additionally, Synechocystis has been modified to produce ethanol from CO$$_2$$ .

Techniques Used in Sll0412 Research

  • Homologous Recombination: Used for creating null and period mutants .

  • Immunofluorescence Analysis: Used to visualize the distribution of proteins within cells .

  • Subcellular Fractionation: Separates cellular components to determine protein localization .

  • CRISPRi: A tool for repressing gene expression .

  • RT-qPCR: Measures gene transcription levels .

  • APMS (Affinity Purification Mass Spectrometry): Identifies protein-protein interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sll0412; UPF0754 thylakoid membrane protein sll0412
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-419
Protein Length
Full Length of Mature Protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll0412
Target Protein Sequence
GGIIGYFTNDLAIKMLFRPYKPLFLGPYQLPFTPGLIPRNQERLAKRVSDTIMGSLLTPE ELQRLARKLLQRERVEGALGWLLQLALKQIREDKQQKTAQILANILRDLFSESLPRLLKA LARQDNFLSDQINRIFDQILLEFRLSELQSRQFADWLLGTVLPPDTIRLALVDFLSDRNI QVIDEGFREKTSGTYWVVANLFGVRNSLTRLRAFCLEEKETANLRLKELLLSLEIRNRLK DWLQQLSLENLPVSTVRQLRRTTGEVVRTYIRERGEPLLKDFGSSVDWDNVAVLIVNRLQ SSTAVTGSLGLVSEELASILERYLEDDLEKIVKQIIPILAIDQVIINRINETPAAELETA VQAIVRSELQAIVNLGGVLGLIIGGLQTGFFLVSRGF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0754 family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is Synechocystis sp. UPF0754 thylakoid membrane protein sll0412?

The UPF0754 thylakoid membrane protein sll0412 is a membrane-bound protein found in the thylakoid membranes of Synechocystis sp. PCC 6803, a freshwater cyanobacterium capable of growing in both freshwater and high-salt conditions. The protein belongs to the UPF0754 family (Uncharacterized Protein Family), indicating its function has not been fully elucidated. Based on its location in the thylakoid membrane, it likely plays a role in photosynthesis, membrane organization, or stress response mechanisms. The full protein spans amino acids 23-419 in its expression region .

Why is sll0412 of interest to researchers studying cyanobacteria?

Researchers are interested in sll0412 for several compelling reasons:

  • As a thylakoid membrane protein, it may participate in photosynthesis, which is fundamental to cyanobacterial metabolism and of significant biotechnological interest.

  • Synechocystis sp. PCC 6803 serves as a model organism for studying photosynthesis and has potential applications in biofuel production, as evidenced by recent research using CRISPR activation systems to upregulate genes involved in isobutanol and 3-methyl-1-butanol biosynthesis .

  • Understanding membrane proteins like sll0412 could provide insights into how cyanobacteria adapt to different environmental conditions, including salt stress. Synechocystis has been shown to grow in seawater-based media when supplemented with appropriate nutrients, indicating remarkable adaptability .

  • The UPF0754 designation indicates its function remains uncharacterized, representing a knowledge gap in our understanding of thylakoid membrane biology.

How can researchers design optimal expression systems for recombinant sll0412?

Researchers seeking to express recombinant sll0412 should consider the following methodological approach:

Expression System Selection:

  • For heterologous expression, E. coli strains specialized for membrane proteins (C41(DE3) or C43(DE3)) may be appropriate

  • For expression in Synechocystis itself, a conjugation-based method can be used as described in recent literature

Expression Optimization Table:

ParameterConsiderationsRecommended Approach
Vector designPromoter strength, tag locationInducible promoters (e.g., rhamnose-inducible as used in CRISPRa systems)
Expression temperatureLower temperatures often improve membrane protein foldingTest 18-25°C range
Induction conditionsConcentration, timingDetermine optimal OD for induction
Purification tagsLocation affects protein foldingC-terminal tags often interfere less with membrane insertion
Buffer compositionStabilization of membrane proteinsTris-based buffer with 50% glycerol as used in commercial preparations

For expression in Synechocystis, researchers have successfully used conjugation methods where "the cargo E. coli strain carrying the target plasmid and the helper strain HB101 containing the pRL443-AmpR plasmid were grown overnight at 37°C in LB, supplemented with 50 μg mL-1 kanamycin and 100 μg mL-1 ampicillin, respectively" .

How can CRISPR activation systems be applied to study sll0412 function?

Recently developed CRISPR activation (CRISPRa) systems for Synechocystis offer powerful tools for studying sll0412 function through targeted upregulation. A methodological approach using these systems would include:

  • System Design: Utilize a rhamnose-inducible CRISPRa system with dCas12a-SoxS protein fusion, which has been demonstrated to recruit RNA polymerase at specific promoters in Synechocystis .

  • Guide RNA Design: Create guide RNAs targeting the promoter region of sll0412, considering that:

    • Optimal targeting region is approximately -100 to -200bp upstream of the transcription start site (TSS)

    • Target the non-template strand opposite the promoter direction for potentially increased activation

    • Design multiple gRNAs to identify the most effective activation positions

  • Expression Control: Use the rhamnose-inducible system to control the timing and level of sll0412 upregulation, allowing for dose-response studies .

  • Phenotypic Analysis: Following upregulation, analyze:

    • Changes in cellular metabolism

    • Alterations in thylakoid membrane structure

    • Effects on photosynthetic efficiency

    • Growth under various stress conditions

This approach leverages the "first cyanobacterial CRISPRa system" that has been reported to significantly expand "the genetic toolkit available for Synechocystis" .

What methodological considerations are important when purifying sll0412 for biochemical studies?

Purification of membrane proteins like sll0412 requires specialized approaches:

Multi-step Purification Protocol:

  • Membrane Isolation:

    • Harvest cells in exponential growth phase

    • Disrupt cells via sonication or French press

    • Separate membrane fraction through ultracentrifugation

  • Detergent Solubilization:

    • Screen detergents (DDM, digitonin, LDAO) for optimal solubilization

    • Maintain protein stability with glycerol (consistent with the 50% glycerol in the storage buffer reported for commercial sll0412)

    • Include protease inhibitors to prevent degradation

  • Affinity Chromatography:

    • Utilize the tag included in the recombinant protein design (as mentioned in the product information: "The tag type will be determined during production process")

    • For His-tagged proteins, use Ni-NTA resin with imidazole gradients

    • Optimize washing steps to reduce non-specific binding

  • Additional Purification:

    • Size-exclusion chromatography to separate monomeric protein from aggregates

    • Ion-exchange chromatography as a polishing step

  • Storage Considerations:

    • Store in Tris-based buffer with 50% glycerol as indicated in the product information

    • Avoid repeated freeze-thaw cycles, consistent with the recommendation: "Repeated freezing and thawing is not recommended"

    • Prepare working aliquots for storage at 4°C for up to one week

How should researchers design experiments to investigate sll0412's role in salt stress response?

Given that Synechocystis can adapt to high-salt conditions including seawater cultivation , investigating sll0412's potential role in salt stress response requires a systematic experimental approach:

  • Expression Analysis:

    • Expose Synechocystis cells to various salt concentrations and monitor sll0412 expression

    • Compare with known salt-responsive genes such as "genes encoding ribosomal proteins, chaperones, and enzymes for glucosylglycerol synthesis"

    • Perform time-course experiments to capture both early and adaptive responses

  • Functional Studies:

    • Generate sll0412 knockout strains using CRISPR-based methods

    • Compare salt tolerance between wild-type and knockout strains

    • Complement knockout strains with wild-type sll0412 to confirm phenotype rescue

  • Localization Analysis:

    • Use fluorescently tagged sll0412 to track potential relocalization during salt stress

    • Examine changes in thylakoid membrane organization

  • Metabolomic Integration:

    • Analyze changes in compatible solutes like "glucosylglycerol and sucrose" that Synechocystis cells accumulate under salt stress

    • Compare metabolite profiles between wild-type and sll0412 mutant strains

  • Ion Homeostasis:

    • Measure Na+ and K+ concentrations, as Synechocystis activates "Na+/H+ antiporter, which decreases the intracellular Na+ concentration, and results in an increase in the K+ concentration to compensate"

Using artificial seawater (ASW) medium supplemented with nitrogen (5 mM NH4Cl) and phosphorus (0.22 mM K2HPO4) sources as described in the literature provides a controlled system for these experiments .

How should researchers control variables when studying sll0412 function?

Effective experimental design for studying sll0412 requires rigorous control of variables according to established principles :

  • Definition of Variables:

    • Independent variables: Genetic manipulation of sll0412, environmental conditions

    • Dependent variables: Protein function, cellular phenotypes, metabolic changes

    • Control variables: Growth conditions, cell density, media composition

  • Experimental Controls Table:

Control TypePurposeImplementation
Negative controlEstablish baselineWild-type strain without manipulation
Positive controlValidate experimental systemKnown thylakoid membrane protein mutant
Vehicle controlAccount for manipulation effectsEmpty vector transformants
Genetic controlControl for off-target effectsComplementation with wild-type sll0412
Technical controlEnsure measurement accuracyInternal standards for quantification
  • Randomization and Blinding:

    • Randomize sample processing order

    • Blind analysis where possible to prevent unconscious bias

  • Replication Strategy:

    • Biological replicates: Multiple independent transformants

    • Technical replicates: Repeated measurements from the same sample

    • Temporal replicates: Repeat experiments on different days

  • Statistical Power:

    • Determine appropriate sample sizes through power analysis

    • Report effect sizes alongside statistical significance

What methodological approaches can identify protein-protein interactions involving sll0412?

Investigating protein-protein interactions for membrane proteins like sll0412 requires specialized approaches:

  • In vivo Approaches:

    • Crosslinking Mass Spectrometry: Use membrane-permeable crosslinkers to stabilize interactions followed by mass spectrometry identification

    • Proximity Labeling: Fuse sll0412 to BioID or APEX2 enzymes that biotinylate proximal proteins

    • Split-Protein Complementation: Use systems adapted for membrane proteins, such as split-GFP or split-ubiquitin

  • Co-purification Methods:

    • Tandem Affinity Purification: Use dual tags to reduce false positives

    • Co-immunoprecipitation: Develop specific antibodies against sll0412

    • Chemical Crosslinking: Stabilize transient interactions before purification

  • Genetic Approaches:

    • Synthetic Genetic Arrays: Identify genetic interactions through double mutant analysis

    • Suppressor Screens: Find mutations that rescue sll0412 mutant phenotypes

  • Validation Strategy:

    • Confirm interactions by reciprocal co-immunoprecipitation

    • Verify biological relevance through functional assays

    • Map interaction domains through mutation analysis

The experimental design must include appropriate controls as outlined in methodological literature, ensuring that dependent and independent variables are clearly defined and that extraneous variables are controlled .

How can researchers optimize growth conditions for studying sll0412 in seawater cultivation experiments?

Seawater cultivation of Synechocystis requires precise optimization of growth conditions to study thylakoid membrane proteins like sll0412:

  • Medium Composition:

    • Use artificial seawater (ASW) supplemented with essential nutrients

    • Add 5 mM NH4Cl as a nitrogen source, as cells "in ASW without a nitrogen source hardly grew"

    • Include 0.22 mM K2HPO4 as a phosphorus source, as cells grown "in the presence of the nitrogen source but in the absence of a phosphorus source grew partially"

    • Add 20 mM HEPES-KOH (pH 7.8) buffer, which improved cell growth as "unlike the cell growth in the ASW medium without HEPES buffer, which started to decrease after 2 days, the cells grew continuously in the presence of HEPES buffer"

  • Growth Monitoring:

    • Track growth by measuring optical density at 730 nm (OD730)

    • Document culture appearance, as research has noted color changes from "yellow-green" to "green" depending on nutrient availability

    • Monitor for at least 3 days to capture complete growth patterns

  • Comparative Experimental Design:

    • Compare growth in ASW medium with standard BG-11 medium

    • Test various salt concentrations to establish dose-response relationships

    • Include wild-type and sll0412 mutant strains in parallel

  • Acclimation Considerations:

    • Allow for adequate acclimation periods when transferring cells between media types

    • Consider pre-conditioning cultures with gradually increasing salt concentrations

This methodological approach accounts for the observation that "Synechocystis 6803 cells could grow in a seawater-based medium supplemented with nitrogen and phosphorus sources, and that the addition of HEPES buffer improved cell proliferation" .

How should researchers distinguish between direct and indirect effects of sll0412 manipulation?

Distinguishing direct from indirect effects is methodologically challenging but essential for accurate interpretation of sll0412 function:

  • Temporal Analysis Approach:

    • Use inducible systems like the rhamnose-inducible CRISPRa system described for Synechocystis

    • Track changes at multiple time points after induction

    • Direct effects typically occur rapidly, while indirect effects emerge later

    • Look for primary responses within minutes to hours versus secondary responses over days

  • Dose-Response Methodology:

    • Vary expression levels of sll0412 using calibrated induction

    • Direct effects often show proportional responses to protein levels

    • Consider that in CRISPRa systems, "activation levels were found to be inversely correlated with the baseline expression levels of the target promoter"

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use network analysis to distinguish primary from secondary nodes

    • Compare with known regulatory networks in Synechocystis

  • Experimental Design Matrix:

ApproachAdvantagesLimitationsImplementation
Acute vs. chronic manipulationSeparates immediate from adaptive responsesMay miss subtle effectsUse inducible systems
Domain-specific mutationsTargets specific functionsRequires structural knowledgeCreate point mutations in functional domains
In vitro reconstitutionDefines minimal required componentsMay not reflect in vivo complexityPurify components and test activity
Compensatory mutationsReveals rescue pathwaysLabor-intensiveScreen for suppressors of sll0412 phenotypes
  • Statistical Treatment:

    • Apply time-series analysis methods to distinguish patterns

    • Use structural equation modeling to test causal relationships

    • Control for confounding variables as emphasized in experimental design literature

This methodological framework helps researchers avoid misattributing secondary effects to direct sll0412 function, ensuring more accurate functional characterization.

What approaches should be used to validate protein localization and dynamics of sll0412?

Validating the localization and dynamics of membrane proteins like sll0412 requires specialized methodological approaches:

  • Fluorescent Protein Fusion Strategies:

    • Create C-terminal and N-terminal fusions to determine optimal tag position

    • Use monomeric fluorescent proteins to minimize aggregation

    • Validate function of fusion proteins compared to wild-type

  • Immunolocalization:

    • Develop specific antibodies against sll0412

    • Optimize fixation to preserve thylakoid membrane structure

    • Use super-resolution microscopy for detailed localization

  • Dynamic Analysis Methods:

    • Fluorescence recovery after photobleaching (FRAP) to measure mobility

    • Single-particle tracking for detailed dynamics

    • Pulse-chase labeling to track protein turnover

  • Environmental Response Monitoring:

    • Track localization changes under various conditions:

      • High salt stress, which induces significant adaptive responses in Synechocystis

      • Different light conditions

      • Nutrient limitation

  • Co-localization Analysis:

    • Determine association with known thylakoid membrane compartments

    • Quantify co-localization coefficients with other proteins

    • Use appropriate statistical tests for co-localization significance

  • Controls and Validation:

    • Include known thylakoid membrane proteins as positive controls

    • Use non-membrane proteins as negative controls

    • Verify localization with multiple independent methods

These approaches allow researchers to determine not just where sll0412 is located within the cell but how its distribution may change in response to environmental conditions, providing insights into its functional role in thylakoid membrane biology.

How can researchers address contradictory findings about sll0412 function?

When faced with contradictory findings about sll0412 function, researchers should employ a systematic resolution approach:

  • Methodological Reconciliation:

    • Directly compare experimental methods from contradictory studies

    • Identify key differences in strain backgrounds, growth conditions, or analytical techniques

    • Design experiments that precisely reproduce both sets of conditions

  • Context-Dependent Function Analysis:

    • Test whether sll0412 functions differently under various conditions

    • Consider that protein function may vary between freshwater and seawater conditions

    • Examine if function changes under different light intensities or nutrient availability

  • Combinatorial Experimental Design:

    • Create a matrix of conditions testing multiple variables simultaneously

    • Use factorial experimental design to identify interaction effects

    • Apply statistical approaches that can detect conditional dependencies

  • Resolution Framework Table:

Contradiction TypeResolution ApproachValidation Method
Different phenotypesTest both conditions side-by-sideQuantitative phenotyping
Opposing biochemical functionsExamine protein modificationsMass spectrometry
Conflicting localizationUse multiple localization methodsSuper-resolution microscopy
Divergent interaction partnersCross-validate with multiple techniquesReciprocal co-immunoprecipitation
  • Integrated Data Analysis:

    • Pool raw data from contradictory studies when available

    • Apply meta-analysis techniques to identify patterns

    • Use systems biology approaches to place contradictions in broader context

This methodological framework follows established experimental design principles that emphasize the importance of clearly defining variables and controlling for extraneous factors that might influence results .

What is the optimal protocol for generating sll0412 knockout strains in Synechocystis?

When creating sll0412 knockout strains, researchers should follow this optimized protocol derived from successful genetic manipulation techniques in Synechocystis:

  • Construct Design:

    • Create a deletion cassette with antibiotic resistance marker flanked by ~1 kb homology arms targeting sll0412

    • Include transcriptional terminators to prevent polar effects on adjacent genes

    • Consider using a marker that can be subsequently removed (e.g., with FLP recombinase)

  • Transformation Protocol:

    • Follow the conjugation-based method described in recent literature:

      • Grow cargo E. coli strain with the knockout construct in LB with 50 μg/mL kanamycin

      • Grow helper strain HB101 containing pRL443-AmpR in LB with 100 μg/mL ampicillin

      • Combine 500 μL of each E. coli strain and wash twice in LB

      • Add 50 μL of Synechocystis cell suspension (OD750 ≈ 1.0) after washing twice in BG11

      • Incubate for 1.5-2 hours at 30°C, 120 rpm, and 50 μmol photons m−2 s−1

  • Selection and Verification:

    • Plate on nitrocellulose membranes on non-selective BG11 plates

    • After 20-24 hours, transfer membranes to selective plates

    • Incubate at 30°C and 50 μmol photons m−2 s−1 until colonies form (5-7 days)

    • Restreak single colonies on selective media and verify by colony PCR

  • Segregation Verification:

    • Confirm complete segregation through multiple rounds of selection

    • Verify by PCR using primers flanking the deletion site

    • Confirm absence of wild-type copies by quantitative PCR

  • Complementation Control:

    • Create complementation strains by reintroducing wild-type sll0412

    • Use an alternative antibiotic marker for selection

    • Verify rescue of knockout phenotypes

This protocol incorporates specific methodological details that have been successfully applied to genetic manipulation in Synechocystis, ensuring efficient generation of knockout strains .

What methods should be used to analyze sll0412 expression levels under different environmental conditions?

When analyzing sll0412 expression under varying environmental conditions, researchers should employ a comprehensive suite of techniques:

  • Transcriptional Analysis:

    • RT-qPCR Protocol:

      • Extract total RNA using TRIzol or specialized kits for cyanobacteria

      • Treat with DNase to remove genomic DNA contamination

      • Perform reverse transcription with random hexamers

      • Use gene-specific primers for qPCR

      • Normalize to multiple reference genes validated for stability under experimental conditions

    • RNA-Seq Approach:

      • Deplete rRNA for higher coverage of mRNA

      • Use strand-specific library preparation

      • Sequence at >20 million reads per sample

      • Apply appropriate normalization methods

      • Validate findings with RT-qPCR for selected genes

  • Protein Level Analysis:

    • Western Blotting:

      • Optimize protein extraction from membrane fractions

      • Use appropriate detergents for solubilization

      • Develop specific antibodies against sll0412

      • Include loading controls appropriate for membrane proteins

    • Targeted Proteomics:

      • Develop Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) assays

      • Use isotopically labeled peptide standards for absolute quantification

      • Target multiple peptides from different regions of sll0412

  • Environmental Conditions to Test:

    • Salt stress (based on Synechocystis adaptation to seawater conditions)

    • Light intensity variations

    • Nutrient limitation (particularly nitrogen and phosphorus)

    • Temperature stress

  • Data Analysis Framework:

    • Apply appropriate statistical tests for multiple comparisons

    • Use time-series analysis for temporal expression patterns

    • Integrate with physiological data to correlate expression with phenotypes

This methodological approach provides a comprehensive analysis of sll0412 expression at both transcriptional and translational levels across diverse environmental conditions.

How can studying sll0412 contribute to cyanobacterial biotechnology applications?

Understanding sll0412 function has several potential applications in cyanobacterial biotechnology:

  • Biofuel Production Enhancement:

    • If sll0412 influences membrane integrity or stress responses, its manipulation could improve biofuel production

    • Recent work has shown that CRISPR activation systems in Synechocystis can be used for "metabolic engineering" to enhance "biosynthesis of the biofuel candidates isobutanol (IB) and 3-methyl-1-butanol (3M1B)"

    • Understanding membrane proteins could help optimize cellular physiology for biofuel production

  • Improved Photosynthetic Efficiency:

    • As a thylakoid membrane protein, sll0412 may influence photosynthetic performance

    • Optimizing photosynthesis is crucial for biotechnological applications

    • Engineered strains with modified sll0412 might show enhanced growth or carbon fixation

  • Enhanced Stress Tolerance:

    • Knowledge of how sll0412 contributes to salt tolerance could enable cultivation in seawater

    • This would reduce competition with freshwater resources for large-scale cultivation

    • Research has shown that Synechocystis "could be grown in a medium based on seawater" when properly supplemented

  • Experimental Strategy Matrix:

ApplicationResearch ApproachExpected OutcomeTechnical Challenges
Biofuel productionCRISPRa upregulation of sll0412Enhanced metabolic fluxBalancing growth with production
Seawater cultivationStress response characterizationImproved salt toleranceMaintaining productivity in high salt
Photosynthetic optimizationStructure-function analysisEnhanced light utilizationBalancing multiple cellular processes
Synthetic biology platformsProtein engineeringNovel membrane functionalitiesMembrane integration of designed proteins
  • Integration with Emerging Technologies:

    • Combine knowledge of sll0412 with CRISPR tools for Synechocystis that "offer a powerful approach for optimising photosynthetic production of high-value compounds"

    • Apply synthetic biology principles to engineer novel functions

These applications represent promising avenues for translating fundamental knowledge about sll0412 into biotechnological innovations.

What are the most important unanswered questions about sll0412 function?

Several critical questions remain unanswered regarding sll0412 function:

  • Fundamental Function:

    • What is the primary biochemical or structural role of sll0412 in thylakoid membranes?

    • Does it function as an enzyme, transporter, structural protein, or regulatory component?

    • How does it contribute to photosynthetic processes?

  • Evolutionary Conservation:

    • How conserved is sll0412 across cyanobacterial species?

    • Are homologs found in other photosynthetic organisms?

    • What does evolutionary conservation reveal about functional importance?

  • Physiological Role:

    • How does sll0412 contribute to salt stress tolerance in Synechocystis?

    • Is it involved in the known salt adaptation mechanisms where "compatible solutes such as glucosylglycerol and sucrose" accumulate?

    • Does it play a role in Na+/H+ antiporter function or K+ homeostasis?

  • Structural Biology:

    • What is the three-dimensional structure of sll0412?

    • How is it oriented in the thylakoid membrane?

    • Which domains are exposed to the cytoplasm versus the thylakoid lumen?

  • Regulatory Networks:

    • What factors regulate sll0412 expression?

    • Is it part of known stress response pathways?

    • Does it interact with regulatory proteins or small molecules?

  • Research Priority Matrix:

Question CategoryResearch PriorityMethodological ApproachPotential Impact
Biochemical functionHighEnzymatic assays, ligand bindingFundamental understanding
Physiological roleHighKnockout phenotyping, stress responseApplied biotechnology
Structural characterizationMediumCryo-EM, X-ray crystallographyStructure-based design
Regulatory mechanismsMediumTranscriptomics, promoter analysisSystems biology integration
Evolutionary significanceLowComparative genomics, phylogeneticsEvolutionary insights

Addressing these questions will require integration of multiple experimental approaches, from molecular genetics to systems biology, and will significantly advance our understanding of thylakoid membrane biology in cyanobacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.