Recombinant Synechocystis sp. Ycf49-like protein (sll0608)

Shipped with Ice Packs
In Stock

Description

Basic Characteristics

The recombinant sll0608 protein is sold as a purified product for experimental use, typically in ELISA kits (Table 1). Key attributes include:

ParameterDescription
Gene IDsll0608
Uniprot AccessionQ55720
Sequence Length104 amino acids
TagDetermined during production (exact type unspecified)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles

Amino Acid Sequence:
MNALSIPTWMVHVSSVIEWIVAIALVSRYATKAGYGHWRALAWGMVPALVSATCACTWHFFDNASQLDWLVTLQALTTVIGNITLCLAAWWIYRQSAQPSAPKP

Source: Commercial ELISA product description

Genomic Context and Hypothetical Function

  • Homology: Ycf49 proteins are often linked to photosynthetic or metabolic processes, though specific roles remain undefined in Synechocystis.

  • Expression Region: The recombinant protein spans residues 1–104 of the full-length gene .

Research Gaps and Challenges

Despite its commercial availability, no peer-reviewed studies have investigated sll0608’s:

  • Enzymatic activity

  • Interactions with photosynthetic complexes

  • Role in stress responses or metabolic pathways

This contrasts with better-characterized Synechocystis proteins, such as phosphate transporters (e.g., sll0679, sll0680) , photorespiratory enzymes (e.g., sll1349) , or secreted proteins (e.g., sll1694) .

Potential Research Directions

Future studies could explore:

  1. Functional Homology: Compare sll0608 to other Ycf49-like proteins in cyanobacteria to infer putative roles.

  2. Localization: Determine subcellular localization (e.g., thylakoid membranes, cytoplasm).

  3. Stress Responses: Investigate expression under conditions like high light, nutrient deprivation, or oxidative stress.

  4. Interaction Networks: Identify binding partners via co-IP or yeast two-hybrid assays.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Please note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type preferences, please inform us and we will prioritize developing the specified tag.
Synonyms
sll0608; Ycf49-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Synechocystis sp. (strain PCC 6803 / Kazusa)
Target Names
sll0608
Target Protein Sequence
MNALSIPTWMVHVSSVIEWIVAIALVSRYATKAGYGHWRALAWGMVPALVSATCACTWHF FDNASQLDWLVTLQALTTVIGNITLCLAAWWIYRQSAQPSAPKP
Uniprot No.

Target Background

Database Links
Protein Families
Ycf49 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key features of cyanobacterial transcription regulatory proteins?

Cyanobacterial transcription regulatory proteins, such as those identified in Synechocystis sp., typically contain distinct functional domains that enable their regulatory activities. For example, the SufR protein (encoded by sll0088 in Synechocystis sp. PCC 6803) exhibits two significant structural features: (i) a DNA-binding domain localized near the N-terminus, and (ii) four highly conserved cysteine residues near the C-terminus. The DNA-binding domain shares high sequence similarity with transcription regulatory proteins and classifies within the DeoR family of helix-loop-helix proteins. Additionally, SufR contains a distinctive C-X12-C-X13-C-X14-C motif near the C-terminus, which likely functions as a metal-binding site. This motif is critical for the protein's ability to harbor an iron-sulfur cluster, as demonstrated through optical and electron paramagnetic resonance spectroscopy .

How are recombinant cyanobacterial proteins typically purified for functional studies?

The purification of recombinant cyanobacterial proteins typically involves a multi-step process that begins with protein expression in a suitable host system. After cell lysis, initial purification often employs size exclusion chromatography (such as Sepharose G-100) to separate proteins based on their molecular size. For proteins that are difficult to purify by conventional methods, preparative polyacrylamide gel electrophoresis in the presence of sodium dodecyl sulfate (SDS-PAGE) can be used, followed by gel excision and electroelution of the target protein. This approach was successfully employed for the purification of the SufR protein from Synechocystis sp., where after size exclusion chromatography, the protein was subjected to SDS-PAGE, located via Coomassie blue staining of a reference lane, excised, and then electroeluted using a Bio-Rad electroelutor .

What experimental approaches are used to determine protein function in Synechocystis?

Determining protein function in Synechocystis typically involves a combination of genetic, biochemical, and physiological approaches. Gene knockout studies are particularly valuable, where targeted gene disruption (often through insertion of antibiotic resistance cassettes) is used to create null mutants. The resulting phenotypes are then analyzed under various growth conditions to infer protein function. For instance, in studies of the sll0088 gene in Synechocystis sp. PCC 6803, null mutants were created by inserting the aphII gene at specific restriction sites. Complete segregation was verified through PCR and Southern blot analysis, while the absence of the encoded protein was confirmed via immunoblot analysis using specific antibodies. Comparative growth studies under different light intensities (e.g., 50 μmol·m⁻²·s⁻¹ vs. 250 μmol·m⁻²·s⁻¹) and iron availability conditions provided insights into the protein's role in iron metabolism .

What spectroscopic techniques are most effective for characterizing iron-sulfur proteins in cyanobacteria?

For characterizing iron-sulfur proteins in cyanobacteria, two complementary spectroscopic techniques have proven particularly effective: optical spectroscopy and electron paramagnetic resonance (EPR) spectroscopy. Optical spectroscopy provides information about the electronic transitions of the iron-sulfur clusters, offering insights into their coordination environment and oxidation state. EPR spectroscopy is especially valuable for examining paramagnetic species within the protein, such as reduced iron-sulfur clusters, providing detailed information about the electronic structure and magnetic properties of these metal centers. These techniques were successfully employed to demonstrate that the expressed Sll0088 protein from Synechocystis sp. strain PCC 6803 harbored an iron-sulfur cluster . When designing experiments using these techniques, researchers should consider both native and recombinant protein forms, as expression systems may affect the proper assembly of iron-sulfur clusters.

How can researchers effectively generate specific antibodies against cyanobacterial proteins?

The generation of specific antibodies against cyanobacterial proteins requires careful planning and execution. A successful approach involves the following steps: (1) Partial purification of the recombinant protein using size exclusion chromatography (e.g., Sepharose G-100); (2) Further purification through preparative SDS-PAGE; (3) Identification of the protein band via Coomassie blue staining; (4) Excision of the gel region containing the target protein; (5) Electroelution of the protein from the gel matrix; and (6) Immunization of animals (typically rabbits) with the purified protein preparation. This methodology was effectively employed to generate polyclonal antibodies against the SufR protein at specialized facilities such as the Centralized Biological Laboratory at Pennsylvania State University . These antibodies can subsequently be used for various applications including Western immunoblotting and immunolocalization studies to investigate protein expression, abundance, and cellular localization.

What approaches can be used to identify DNA-binding sites for transcriptional regulators in cyanobacteria?

Identifying DNA-binding sites for transcriptional regulators in cyanobacteria requires specialized techniques that probe protein-DNA interactions. Effective approaches include:

  • Electrophoretic Mobility Shift Assays (EMSAs): This technique allows visualization of protein-DNA complexes based on their retarded migration through non-denaturing polyacrylamide gels compared to free DNA.

  • DNase I Footprinting: This method identifies protected DNA regions that are bound by the protein and thus resistant to DNase I digestion.

  • Chromatin Immunoprecipitation (ChIP): This in vivo approach uses antibodies to isolate protein-DNA complexes from cells, followed by sequencing or PCR to identify bound DNA sequences.

  • Systematic Evolution of Ligands by Exponential Enrichment (SELEX): This iterative method enriches DNA sequences with high affinity for the target protein.

For cyanobacterial transcription factors like SufR, which has a DNA-binding domain characteristic of the DeoR family of helix-loop-helix proteins, these techniques have proven valuable for identifying specific regulatory sequences. Combining these approaches with transcriptomic analyses (e.g., comparing mRNA levels of potential target genes between wild-type and null mutant strains) provides compelling evidence for transcriptional regulation. As observed with SufR, null mutants exhibited elevated expression levels of sufBCDS genes compared to wild-type strains, particularly under oxidative and iron stress conditions .

What factors should be considered when designing experiments to assess the role of iron-sulfur proteins in stress responses?

When designing experiments to assess the role of iron-sulfur proteins in stress responses, researchers should consider several critical factors:

  • Stress Conditions Selection: Carefully select physiologically relevant stress conditions that may affect iron-sulfur cluster biosynthesis or stability, such as:

    • Oxidative stress (e.g., exposure to H₂O₂ or methyl viologen)

    • Iron limitation (achieved through chelators or iron-free media)

    • Light stress (varying intensity and quality)

  • Time-Course Analyses: Implement time-resolved experiments to capture both immediate and adaptive responses, as gene expression patterns may shift over time.

  • Comparative Genetic Approaches: Include wild-type strains alongside null mutants and, when possible, complemented strains to establish causality.

  • Multi-Parameter Phenotyping: Measure multiple parameters including:

    • Growth rates under different conditions

    • Pigment composition changes

    • Photosynthetic efficiency

    • Protein expression levels of both the target protein and related pathway components

Research on the SufR protein (sll0088) demonstrated that compared to wild-type, expression levels of sufBCDS genes were elevated when cells were grown under oxidative and iron stress conditions. Moreover, these expression levels were even higher in null mutants where the sll0088 homolog was inactivated. The growth rate of null mutants was significantly higher than wild-type under iron-limiting conditions, providing strong evidence for SufR's role in iron metabolism regulation .

How should researchers design control experiments when studying recombinant protein expression in cyanobacteria?

Designing appropriate control experiments for recombinant protein expression studies in cyanobacteria requires careful consideration of several factors to ensure valid and interpretable results:

  • Expression Vector Controls:

    • Empty vector control: Cells transformed with the expression vector lacking the gene of interest

    • Positive control: Expression of a well-characterized protein using the same vector system

    • Promoter controls: Testing baseline activity and induction conditions of the selected promoter

  • Expression Condition Controls:

    • Uninduced vs. induced samples: When using inducible promoters, compare protein expression profiles before and after induction

    • Time-course sampling: Collect samples at multiple time points to determine optimal expression periods

    • Growth parameter monitoring: Track optical density, chlorophyll content, and cellular morphology to assess physiological impacts

  • Protein Characterization Controls:

    • Size markers: Include appropriate molecular weight standards during SDS-PAGE

    • Purification controls: Process wild-type cell extracts through the same purification protocol to identify potential contaminating proteins

    • Antibody specificity: Test antibodies against extracts from wild-type and mutant strains to confirm specificity

In studies involving the SufR protein, researchers employed comprehensive controls including uninduced cells, induced cells, inclusion bodies, and purified proteins for SDS-PAGE and immunoblotting analyses. Additionally, when creating null mutants, they inserted the aphII gene in both parallel and antiparallel orientations relative to the target gene's transcription direction to assess potential polar effects on downstream genes .

What experimental design considerations are important when analyzing transcriptional regulators through mutant studies?

When analyzing transcriptional regulators through mutant studies, several experimental design considerations are crucial for generating reliable and interpretable data:

  • Mutant Construction Strategy:

    • Complete vs. partial gene disruption: Ensure complete inactivation of the target gene

    • Insertion site selection: Consider potential effects on upstream or downstream genes

    • Marker gene orientation: Test both parallel and antiparallel orientations of selection markers

    • Segregation verification: Confirm complete segregation of mutant chromosomes through PCR and Southern blotting

  • Phenotypic Characterization Protocol:

    • Growth condition matrix: Test multiple environmental conditions relevant to the regulator's function

    • Temporal resolution: Monitor phenotypes across different growth phases

    • Quantitative measurements: Use precise quantitative methods rather than qualitative observations

  • Transcriptional Analysis Approach:

    • Target gene selection: Analyze expression of both direct and indirect potential targets

    • Normalization strategy: Carefully select reference genes stable under the test conditions

    • Technical replication: Include sufficient technical replicates for statistical robustness

  • Complementation Studies:

    • Expression level control: Use native or controllable promoters to restore wild-type expression levels

    • Variant analysis: Test functional importance of specific domains through complementation with modified versions

As demonstrated in studies of the sll0088 gene (sufR), researchers created null mutants by inserting the aphII gene at specific restriction sites. They verified complete segregation through PCR and Southern blot analysis and confirmed the absence of the encoded protein via immunoblotting. By comparing mRNA levels of sufB, sufC, sufD, and sufS genes between wild-type and null mutant strains, they established SufR's role as a transcriptional repressor of the suf operon .

How can researchers effectively analyze differential gene expression data in the context of transcriptional regulator studies?

Effective analysis of differential gene expression data in transcriptional regulator studies requires a systematic approach that combines statistical rigor with biological context:

  • Experimental Design Considerations:

    • Include biological replicates (minimum 3-4) to account for biological variability

    • Control for environmental factors that might influence gene expression

    • Include time-course measurements when studying dynamic responses

  • Normalization and Statistical Analysis:

    • Apply appropriate normalization methods to account for technical variations

    • Utilize statistical tests with multiple testing corrections to identify significantly differentially expressed genes

    • Consider both fold change and statistical significance when identifying regulated genes

  • Contextual Interpretation Framework:

    • Compare expression patterns across different conditions (e.g., wild-type vs. mutant, normal vs. stress conditions)

    • Group genes by functional categories or metabolic pathways

    • Identify potential direct vs. indirect regulatory effects

When studying the SufR transcriptional regulator in cyanobacteria, researchers observed that expression levels of sufBCDS genes were elevated in cells grown under oxidative and iron stress conditions compared to wild-type. These expression levels were even higher in null mutants where the sll0088 homolog was inactivated. This pattern strongly suggested that SufR functions as a transcriptional repressor of the suf operon, with its regulatory activity potentially modulated by environmental conditions affecting iron metabolism .

What approaches are recommended for resolving contradictory results in protein characterization studies?

When faced with contradictory results in protein characterization studies, researchers should implement a systematic troubleshooting approach:

  • Method Validation and Technical Considerations:

    • Verify reagent quality and instrument calibration

    • Repeat experiments with independent reagent preparations

    • Test alternative methodological approaches for the same measurement

    • Consult with specialists in specific technical domains

  • Biological Variable Assessment:

    • Evaluate protein heterogeneity (post-translational modifications, alternative splicing)

    • Consider protein stability and storage conditions

    • Assess potential cofactor requirements

    • Examine protein-protein interactions that might affect function

  • Experimental Design Re-evaluation:

    • Review control experiments for adequacy

    • Consider environmental variables that might influence results

    • Adjust time points or conditions to capture dynamic processes

  • Collaborative Verification Strategy:

    • Engage independent laboratories to replicate key findings

    • Employ complementary techniques to address the same question

    • Conduct blind analyses to minimize expectation bias

  • Literature Reconciliation:

    • Conduct a systematic review of related studies

    • Identify methodological differences that might explain discrepancies

    • Consider species-specific or strain-specific variations

When characterizing proteins like SufR, researchers might encounter contradictory results regarding its regulatory function. In such cases, employing multiple approaches—such as combining gene expression analysis, growth phenotyping under various conditions, and direct protein-DNA interaction studies—provides robust evidence for functional characterization .

What cutting-edge approaches are available for determining the function of hypothetical proteins in Synechocystis?

Determining the function of hypothetical proteins in Synechocystis has been revolutionized by several cutting-edge approaches that combine classical biochemistry with modern -omics technologies:

  • Multi-omics Integration Strategies:

    • Integrate transcriptomics, proteomics, and metabolomics data to place the protein within functional networks

    • Apply correlation network analysis to identify co-regulated genes and proteins

    • Utilize comparative genomics across multiple cyanobacterial species to infer functional conservation

  • Advanced Genetic Manipulation Techniques:

    • CRISPR-Cas9 genome editing for precise modification without marker genes

    • Inducible expression systems for temporal control of gene expression

    • Synthetic biology approaches to test protein function in heterologous contexts

  • Structural Biology Methods:

    • Cryo-electron microscopy for visualization of protein complexes in near-native states

    • Nuclear magnetic resonance (NMR) for dynamic structural information

    • X-ray crystallography for high-resolution structural determination

  • In vivo Protein Localization and Interaction Studies:

    • Fluorescent protein tagging for subcellular localization

    • Split-protein complementation assays for protein-protein interactions

    • Proximity-dependent biotin identification (BioID) for mapping protein interaction networks

For proteins like SufR in Synechocystis, combining genetic analyses (null mutant phenotyping), biochemical characterization (iron-sulfur cluster identification through spectroscopy), and transcriptional studies (mRNA level comparison) provided comprehensive evidence for its function as a transcriptional repressor of the suf operon involved in iron-sulfur cluster assembly .

How can researchers effectively design experiments to elucidate protein-protein interactions in cyanobacterial systems?

Designing experiments to elucidate protein-protein interactions in cyanobacterial systems requires careful consideration of the unique aspects of these photosynthetic prokaryotes:

  • Selection of Appropriate Methodologies:

    • Co-immunoprecipitation (Co-IP): Utilizes specific antibodies to isolate protein complexes

    • Pull-down assays: Uses tagged recombinant proteins as bait to capture interacting partners

    • Bacterial two-hybrid (B2H) systems: Measures protein interactions through transcriptional activation

    • Surface plasmon resonance (SPR): Quantifies binding kinetics between purified proteins

  • Experimental Design Considerations:

    • Growth conditions: Test interactions under various physiological states (e.g., different light intensities, nutrient availability)

    • Time-course analysis: Capture dynamic interactions that may change during cellular responses

    • Subcellular fractionation: Separate membrane, cytosolic, and thylakoid compartments prior to interaction studies

    • Crosslinking approaches: Stabilize transient interactions through chemical crosslinking

  • Control Experiments:

    • Negative controls: Include non-interacting proteins to establish background levels

    • Positive controls: Include known interacting pairs to validate experimental conditions

    • Competitive binding: Test specificity through competition with unlabeled proteins

    • Mutational analysis: Confirm interaction sites through targeted mutations

  • Data Validation Strategy:

    • Orthogonal methods: Confirm interactions using multiple independent techniques

    • Functional correlation: Correlate interactions with functional outcomes

    • Quantitative analysis: Measure interaction strengths under different conditions

In studies of iron-sulfur cluster assembly proteins like those in the Suf pathway, elucidating protein-protein interactions is crucial for understanding the mechanistic details of cluster biosynthesis and transfer. The relationship between regulatory proteins like SufR and their target proteins can be investigated through these approaches to develop comprehensive models of regulatory networks in cyanobacteria .

What are the most significant challenges and future research directions in studying recombinant cyanobacterial proteins?

The study of recombinant cyanobacterial proteins presents several significant challenges that define important future research directions. These include optimizing expression systems specifically tailored to the unique physiology of cyanobacteria, developing improved methods for purifying membrane-associated and hydrophobic proteins that are abundant in these photosynthetic organisms, and establishing standardized protocols for functional characterization that account for the complex regulatory networks operating under different environmental conditions. The integration of systems biology approaches with traditional biochemical methods offers promising avenues for elucidating the functions of the numerous hypothetical proteins still annotated in cyanobacterial genomes. Additionally, investigating the dynamic regulation of protein function in response to environmental cues, particularly those related to light quality and quantity, represents an important frontier in cyanobacterial protein research. Future work should also focus on developing more efficient genetic tools for manipulating cyanobacteria and establishing high-throughput methodologies for functional screening of recombinant proteins in these organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.