Recombinant Syntrophobacter fumaroxidans ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Production and Supplier Information

The recombinant atpF subunit is commercially available through specialized biotechnology providers:

SupplierContactCountryProduct Catalog
CUSABIO TECHNOLOGY LLC1-1 027-87196173 / cusabio@163.comChina58+ products

These suppliers emphasize high-purity recombinant proteins for biochemical assays and structural studies .

Research Applications and Findings

The recombinant atpF subunit enables targeted investigations into ATP synthase mechanics:

  • Structural Studies: His-tagged atpF facilitates crystallization or cryo-EM analysis to resolve interactions between F₀ subunits (e.g., a, b, c) .

  • Functional Assays: In vitro measurements of proton translocation rates or ATP hydrolysis/synthesis activity can elucidate energy-coupling mechanisms .

Recent proteomic studies highlight S. fumaroxidans’s reliance on ATP synthase for syntrophic metabolism, though direct atpF quantification remains underexplored .

Comparison with Other ATP Synthase Subunits

The atpF subunit differs from Mycobacterium’s α subunits in lacking a C-terminal regulatory domain that suppresses ATPase activity . This distinction underscores species-specific adaptations in ATP synthase regulation.

FeatureSyntrophobacter atpFMycobacterium α Subunit
Length203 amino acids (full-length)502 amino acids
Regulatory DomainsNone reportedC-terminal extension (36 aa)
ATPase ActivityLikely activeSuppressed in wild-type

Future Directions

  • Mechanistic Studies: Investigating the proton translocation stoichiometry of atpF in S. fumaroxidans.

  • Biotechnological Applications: Leveraging recombinant atpF for bioenergy systems or bioelectrochemical reactors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Sfum_2586; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Target Names
atpF
Target Protein Sequence
MHAGVRGKKERAKFVWPLLGAGLLLAAEGVAWASGGGGEHGGGHLNWSDFLARTLVFVIT FSILFKLLKKPIAGFFSSRKAEIQRLLSELELKQKEAEQNHAECKAKLAALEVETKKIVD ELIAEGEVERQKIIEAAEKQADYLRQQADVAIQQEIKAAREKLKLEISELSVAAAEEILR KNMKAKDQDRLVRDFMKRVVEAK
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembranous catalytic core; and F0, the membrane proton channel. These are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How does phosphorylation affect the function of ATP synthase β subunit, and what implications might this have for studying S. fumaroxidans atpF interactions?

    Phosphorylation of ATP synthase β subunit serves as a critical regulatory mechanism affecting both structure and function of the complex. Research on model systems has revealed:

    Phosphorylation SiteFunctional ImpactStructural Effect
    T262 (phospho-mimetic)Complete inhibition of ATPase activityMinimal impact on complex assembly
    T58 (phospho-mimetic)Moderate impact on activitySignificant reduction in dimer formation
    T318 (phospho-mimetic)Minimal effect on ATPase activitySimilar assembly pattern to wild-type

    For S. fumaroxidans atpF research, this suggests that:

    1. Post-translational modifications may serve as regulatory mechanisms adapting ATP synthase function to the extreme energy limitations of syntrophic growth

    2. Interactions between atpF and the β subunit might be influenced by phosphorylation status

    3. Experimental design should consider potential phosphorylation sites when analyzing subunit interactions and enzymatic activity

    These insights are particularly relevant when studying how S. fumaroxidans maintains ATP homeostasis under the thermodynamic constraints of syntrophic metabolism .

  • What role does ATP synthase play in syntrophic relationships involving S. fumaroxidans, and how might recombinant atpF be used to study these interactions?

    ATP synthase plays a multifaceted role in the syntrophic lifestyle of S. fumaroxidans:

    1. Energy conservation: During propionate oxidation, ATP synthase captures the limited energy available through proton motive force utilization

    2. Reverse operation: Under certain conditions, ATP synthase may operate in reverse to generate proton motive force necessary for endergonic reactions in the methylmalonyl-CoA pathway

    3. Metabolic adaptation: Proteomic analysis of syntrophic cocultures revealed that while many metabolic enzymes show significant upregulation during syntrophic growth, ATP synthase expression remains relatively stable, suggesting a strategy to conserve energy

    Recombinant atpF can be used to study these interactions through:

    • Reconstitution experiments combining recombinant subunits to study how the complete ATP synthase functions under syntrophic conditions

    • Site-directed mutagenesis to identify key residues involved in maintaining efficiency under energy-limited conditions

    • Protein-protein interaction studies to map the associations between ATP synthase and other components of energy conservation systems

    Such approaches could reveal how S. fumaroxidans maintains energy homeostasis while operating near thermodynamic limits .

  • How does the proton motive force generation differ in S. fumaroxidans compared to other bacteria, and what role does atpF play in this process?

    S. fumaroxidans exhibits distinct mechanisms for proton motive force (PMF) generation compared to other bacteria:

    1. Reverse electron transport: During propionate oxidation, S. fumaroxidans must drive the highly endergonic oxidation of succinate to fumarate, requiring PMF input rather than generation

    2. Syntrophic adaptations: The genome encodes multiple electron transfer complexes and hydrogenases that contribute to PMF generation during interspecies electron transfer

    3. Formate as alternative electron carrier: Proteomic analysis shows significant upregulation of formate dehydrogenases during syntrophic growth, suggesting formate may serve as an electron carrier in addition to hydrogen

    The atpF subunit contributes to these processes by:

    • Maintaining the structural integrity of the ATP synthase complex during both forward and reverse operation

    • Anchoring the stator stalk that prevents rotation of the F₁ domain relative to the F₀ domain

    • Potentially participating in conformational changes that optimize ATP synthase efficiency under varying energetic conditions

    These adaptations allow S. fumaroxidans to maintain energy conservation while operating at the thermodynamic limits of life .

  • What methodological approaches can be used to study the Ca²⁺ binding properties of ATP synthase β subunit, and how might this inform research on S. fumaroxidans atpF?

    Research on Ca²⁺ binding to ATP synthase β subunit employs multiple complementary methodologies:

    1. In vitro enzymatic assays:

      • Comparing Ca²⁺-ATP and Mg²⁺-ATP hydrolysis rates

      • Analyzing the impact of T163S mutations on cation specificity

    2. In vivo functional studies:

      • Cell-based Ca²⁺ retention capacity (CRC) assays

      • Measurement of mitochondrial membrane potential in response to Ca²⁺

    3. In silico structural analyses:

      • Molecular dynamics (MD) simulations comparing cation coordination

      • Computational prediction of conformational changes propagating from catalytic sites

    For S. fumaroxidans atpF research, these approaches can:

    • Identify potential interaction mechanisms between atpF and the β subunit during cation binding

    • Elucidate how S. fumaroxidans ATP synthase might respond to different cation environments

    • Reveal potential regulatory mechanisms for ATP synthesis/hydrolysis balance during syntrophic growth

    Understanding these properties is particularly relevant considering that S. fumaroxidans must maintain efficient energy conservation while operating at exceptionally low energy yields during syntrophic metabolism .

  • How do pH-dependent subunit interactions in ATP synthase influence enzyme function, and what implications might this have for S. fumaroxidans atpF research?

    pH-dependent subunit interactions in ATP synthase reveal complex regulatory mechanisms:

    pH ConditionObserved EffectMechanistic Basis
    Acidic pHEnhanced proton translocation efficiencyOptimal protonation state of input channel residues
    Neutral pHBalanced synthesis/hydrolysisEquilibrium between protonated/deprotonated states
    Alkaline pHShifted equilibrium toward hydrolysisAltered protonation state of output channel residues

    Single-molecule rotation studies have identified pH-dependent 11° sub-steps in ATP synthase operation that reflect:

    1. Proton transfer events between subunit-a and c-ring residues

    2. Conformational changes propagating through the enzyme complex

    3. Alterations in pKa values of proton half-channels affecting energy transduction

    For S. fumaroxidans atpF research, these findings suggest:

    • The need to consider pH as a critical variable in experimental design

    • Potential adaptations in atpF structure that optimize function under the acidogenic conditions often present during syntrophic growth

    • Importance of characterizing how atpF contributes to maintaining ATP synthase function across varying pH conditions

    These considerations are particularly relevant given that syntrophic bacteria must often function in fluctuating pH environments while maintaining energy efficiency .

  • What techniques can be employed to study electron bifurcation/confurcation systems in syntrophic bacteria, and how might these relate to ATP synthase function?

    Research on electron bifurcation/confurcation systems in syntrophic bacteria employs several sophisticated techniques:

    1. Transcriptomic analysis:

      • RNA-Seq to compare gene expression under syntrophic vs. monoculture conditions

      • Identification of co-regulated gene clusters (e.g., upregulation of hydrogenase, formate dehydrogenase, and ATP synthase genes)

    2. Biochemical characterization:

      • Enzyme activity assays under varying electron donor/acceptor conditions

      • Reconstitution of electron transfer complexes with purified components

    3. Bioenergetic measurements:

      • Membrane potential determination using fluorescent probes

      • H₂ and formate production rates under different growth conditions

    These studies reveal that in syntrophic bacteria:

    • Electron bifurcation systems (e.g., Fix complex, Fe-hydrogenase III) are significantly upregulated during syntrophic growth

    • ATP synthase likely interacts with these systems to maintain redox balance and energy conservation

    • Formate dehydrogenases may serve dual roles in electron disposal and energy conservation

    For S. fumaroxidans atpF research, understanding these interactions could reveal how the ATP synthase complex is integrated with electron bifurcation systems to maintain energy efficiency under the extreme thermodynamic constraints of syntrophic growth .

  • What approaches can be used to study the role of ATP synthase in interspecies electron transfer during syntrophic growth of S. fumaroxidans?

    Investigating ATP synthase's role in interspecies electron transfer requires multifaceted approaches:

    1. Comparative proteomic analysis:

      • Quantification of ATP synthase subunit abundance in different syntrophic partnerships

      • Identification of differential post-translational modifications under varying syntrophic conditions

    2. Coculture experiments:

      • Comparing S. fumaroxidans growth with different syntrophic partners (e.g., methanogens vs. iron reducers)

      • Measuring metabolic rates and yields to assess energy conservation efficiency

    3. Genetic manipulation:

      • Site-directed mutagenesis of atpF to assess impact on syntrophic growth

      • Expression of modified ATP synthase variants to probe structure-function relationships

    Recent research on S. fumaroxidans-G. sulfurreducens cocultures revealed:

    • Complex interspecies electron transfer mechanisms potentially involving both hydrogen/formate transfer and direct interspecies electron transfer

    • Differential abundance of electron transfer proteins compared to methanogenic partnerships

    • Significantly lower propionate conversion rates (8-fold) compared to partnerships with methanogens

    These findings suggest ATP synthase may function differently depending on the syntrophic partner, potentially adapting to optimize energy conservation based on the electron acceptor used by the partner organism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.