Recombinant Syntrophobacter fumaroxidans Macrolide export ATP-binding/permease protein MacB (macB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

MacB in Antibiotic Resistance:

  • Mediates efflux of macrolides (e.g., erythromycin), aminoglycosides, and polymyxins in Gram-negative bacteria .

  • Co-expressed with MacA and TolC to form a tripartite pump, enabling drug extrusion across the cell envelope .

Syntrophic Metabolism Context:
While S. fumaroxidans primarily relies on succinate dehydrogenases (e.g., SdhABC) and fumarate reductases (FrdABEF) for propionate oxidation , MacB may support survival under antibiotic stress in mixed microbial communities.

Research Applications

Key Uses:

  • Drug Resistance Studies: Screening macrolide efflux mechanisms .

  • Structural Biology: Analyzing ATPase activity and transmembrane transport dynamics .

  • Syntrophic Interaction Models: Investigating antibiotic impacts on anaerobic consortia .

Experimental Data:

  • ATPase Activity: MacB hydrolyzes ATP to energize substrate translocation, with activity modulated by transmembrane proton gradients .

  • Expression Regulation: In Salmonella and E. coli, MacAB operons are induced by antimicrobial peptides via the PhoPQ system .

Comparative Analysis with Homologs

FeatureS. fumaroxidans MacB (Inferred)Wolinella succinogenes MacB Pseudomonas aeruginosa MacB
Substrate SpecificityMacrolides, aminoglycosidesMacrolidesToxins, siderophores
Genetic RegulationUncharacterizedConstitutivePhoPQ-dependent
Structural MotifsABC transporter domainsABC transporter domainsABC transporter + adaptor-binding site

Challenges and Future Directions

  • Functional Validation: Direct evidence for MacB’s role in S. fumaroxidans is limited; studies require genetic knockout models .

  • Ecological Impact: Assess how MacB activity influences microbial community resilience in anaerobic digesters exposed to antibiotics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format preference, please indicate your requirement during order placement. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please communicate this need in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
Prior to opening the vial, we recommend a brief centrifugation to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of the protein is influenced by factors such as storage conditions, buffer composition, storage temperature, and inherent protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
macB; Sfum_2810; Macrolide export ATP-binding/permease protein MacB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Target Names
macB
Target Protein Sequence
MDLIELQDIRKTYRLGEIDVPVLRGISLKVSPGDFVALMGTSGSGKTTLMNILGCLDRPT SGHYRFDGQDVVDLTPDQRAALRNRKIGFVFQNFNLLPRMSAVENVMMPLSYAGGGVSDQ NGRERAGALLTRMGLGEHLDNEPSQLSGGQQQRVAIARALINNPSLLFADEPTGNLDSAT SEEVLRVFQRLNEEEGVTIILVTHDPSVAQCARRIVRIRDGVIEPESGAVGDMPQVSKAA PAQSKPVHSAMRRGDLDKFRRSLHTALSSLRRNVLRAALTTLGIIIGVAAVIAMMEIGRG SSTAIQRTIASMGAHTLALLPGTAASGGVSFGGGSVMTMTPQDSEAIVNECPAVLAAAPI VRARTQVVHGSRNWVPAGIYGTTPTFLEIREWPLAEGDVFTERDVRNASKVCVLGQRLVD ELFQGENPIGLEVRIKNVAFKVIGVLSPKGANMMGMDQDDLLLAPWTAIKYRVTGSSLAN VNQSAASTSSASITDQVNSLSNLYPTEKVVLYPEISTTQAFDTPLPVRFTNVDQILVGIR STSGTRAAIRQIGEVLRERHRLRPGEPDDFSVRDMTEMTKTLASTATMMTKLLLAVALIS LIVGGVGIMNIMMVSVTERTREIGLRMAVGARAKNILQQFLFEAVLLCFLGGAVGILVGR GISHLVTVLLNWPTELSLDAILAAVGVSATVGIVFGYYPAWKASRLDPIVALRYE
Uniprot No.

Target Background

Function
This protein is a non-canonical ABC transporter that contains transmembrane domains (TMD), which form a pore in the inner membrane, and an ATP-binding domain (NBD), responsible for energy generation. It confers resistance against macrolides.
Database Links
Protein Families
ABC transporter superfamily, Macrolide exporter (TC 3.A.1.122) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Syntrophobacter fumaroxidans and what is its significance in microbial ecology?

Taxonomically, S. fumaroxidans belongs to:

  • Domain: Bacteria

  • Phylum: Thermodesulfobacteriota

  • Class: Syntrophobacteria

  • Order: Syntrophobacterales

  • Family: Syntrophobacteraceae

  • Genus: Syntrophobacter

The ecological significance of this organism lies in its ability to thrive in syntrophic associations with methanogens like Methanospirillum hungatei or Methanobacterium formicicum that utilize hydrogen and formate to make propionate oxidation energetically favorable . Its metabolic versatility allows it to grow in various conditions:

  • In pure culture using sulfate or fumarate as electron acceptors

  • In syntrophic coculture with hydrogen/formate scavengers

  • As a sulfate reducer with propionate as an electron donor

What metabolic pathways are characteristic of S. fumaroxidans?

S. fumaroxidans metabolizes propionate using the methylmalonyl-CoA (MMC) pathway. This pathway involves several key steps:

  • Conversion of propionate to succinate

  • Oxidation of succinate to fumarate

  • Conversion of fumarate to malate

  • Oxidation of malate to oxaloacetate

  • Conversion of oxaloacetate to pyruvate

  • Oxidation of pyruvate to acetyl-CoA plus CO2

In this pathway, electrons are produced in three oxidation steps:

  • Succinate to fumarate

  • Malate to oxaloacetate

  • Pyruvate to acetyl-CoA plus CO2

These electrons then reduce protons to hydrogen or protons plus CO2 to formate, which are transferred to methanogenic partners in syntrophic relationships .

Of particular note is the oxidation of succinate via menaquinone, which is highly endergonic since the midpoint potential of succinate (+30 mV) is much more positive than menaquinone (-80 mV), requiring a transmembrane proton gradient to function .

What is the MacB protein and what is its role in bacterial physiology?

MacB is an ATP-binding cassette (ABC) transporter that collaborates with the MacA adaptor protein and TolC exit duct to form a tripartite efflux pump system. This system drives the efflux of antibiotics and enterotoxin STII out of bacterial cells .

The distinctive feature of MacB is its transmembrane domain, which lacks a central cavity through which substrates typically pass in other transporters. Instead, MacB utilizes a mechanism called "mechanotransmission," conveying conformational changes from one side of the membrane to the other .

In the ATP-bound state, the reversible dimerization of the nucleotide binding domains drives opening and closing of the MacB periplasmic domains. This occurs via concerted movements of the second transmembrane segment and major coupling helix. The assembled tripartite pump acts as a molecular bellows to propel substrates through the TolC exit duct .

How does the structure of MacB relate to its mechanotransmission function?

The structure of MacB reveals a unique architecture that facilitates mechanotransmission:

  • Transmembrane Domain Structure: Unlike typical ABC transporters, MacB lacks a central substrate-binding cavity. Instead, its structure is optimized to transmit conformational changes across the membrane.

  • Nucleotide Binding Domains (NBDs): The comparison of ATP-bound and nucleotide-free states shows how ATP binding and hydrolysis drive conformational changes. ATP binding causes NBD dimerization, which initiates a cascade of structural changes.

  • Periplasmic Domains: These domains open and close in response to NBD movements, functioning as a molecular bellows.

  • Transmembrane Segments: The second transmembrane segment plays a crucial role in conveying conformational changes from the NBDs to the periplasmic domains.

  • Major Coupling Helix: This structural element translates the conformational changes between domains .

This mechanism serves as a blueprint for understanding an entire ABC transporter superfamily that includes proteins like the LolCDE lipoprotein trafficking complex and FtsEX cell division signaling protein .

What growth conditions are optimal for culturing S. fumaroxidans in laboratory settings?

Based on experimental protocols from the literature, S. fumaroxidans requires the following growth conditions:

  • Growth Medium: Bicarbonate-buffered medium in serum bottles (typically 120-ml bottles with 50 ml medium)

  • Temperature: 35°C

  • Atmosphere: Strict anaerobic conditions with N2/CO2 (80:20, v/v) as the headspace

  • Electron Donors: Propionate (typically 10-20 mM sodium propionate added from sterile anoxic stock solutions)

  • Electron Acceptors: Options include:

    • Fumarate (60 mM) for pure culture growth

    • Sulfate for growth as a sulfate reducer

    • No additional acceptor when growing in syntrophic coculture with methanogens

  • Adaptation Period: Multiple transfers (at least five subsequent transfers of 10% v/v) to fresh media with respective electron donors and acceptors

For coculture experiments, such as with Geobacter sulfurreducens, researchers have successfully used propionate (10 mM) as the electron donor and Fe(III) citrate (80 mM) as the electron acceptor in the same medium as used for pure cultures .

What experimental design principles should be applied when studying S. fumaroxidans and MacB?

When designing experiments involving S. fumaroxidans and MacB, researchers should consider several key principles:

  • Control of Variables: Implement randomized blocks, Latin square designs, or factorial designs to control for confounding variables. This is especially important when studying the effects of different growth conditions or genetic modifications .

  • Factorial Design Contexts: Use factorial design to systematically investigate multiple factors simultaneously, such as:

    • Temperature variations

    • Different electron donors/acceptors

    • Coculture partner species

    • Genetic modifications affecting MacB expression

  • Response Surface Methodologies: Implement these to optimize growth conditions or protein expression levels .

  • Random and Mixed Effects Models: These are valuable when accounting for batch-to-batch variation in bacterial cultures or protein expression .

  • Split-Plot and Strip-Plot Designs: Consider these approaches when some factors are harder to randomize than others (e.g., anaerobic vs. aerobic conditions might require different chambers) .

For rigorous statistical analysis, software like JMP offers capabilities for creating, analyzing, and understanding various experimental designs including factorial, response surface, and advanced designs .

What are the key challenges in expressing recombinant MacB from S. fumaroxidans?

Expressing recombinant membrane proteins like MacB from an anaerobic bacterium such as S. fumaroxidans presents several challenges:

  • Membrane Protein Solubility: MacB is a transmembrane protein, making it inherently difficult to express in soluble form. Researchers must optimize detergent selection for solubilization and purification.

  • Expression Host Selection: The choice between prokaryotic (E. coli) and eukaryotic expression systems involves trade-offs. While E. coli offers simplicity and high yields, eukaryotic systems may provide better folding for complex proteins.

  • Anaerobic Protein Adaptations: Proteins from strict anaerobes like S. fumaroxidans may have structural features adapted to low-oxygen environments, potentially affecting folding and stability when expressed in aerobic systems.

  • Codon Optimization: S. fumaroxidans likely has different codon usage patterns compared to common expression hosts, necessitating codon optimization for efficient expression.

  • Post-Translational Modifications: If MacB requires specific post-translational modifications in S. fumaroxidans, these may be absent in heterologous expression systems.

These challenges require systematic optimization of expression conditions and often necessitate screening multiple constructs and expression systems.

How can researchers verify the functional integrity of recombinant MacB?

Verification of functional integrity for recombinant MacB should include:

  • Structural Analysis:

    • X-ray crystallography to determine if the protein structure matches the known ATP-bound and nucleotide-free states of MacB

    • Circular dichroism spectroscopy to assess secondary structure composition

  • ATPase Activity Assays:

    • Measurement of ATP hydrolysis rates using colorimetric phosphate detection assays

    • Comparison of activity with and without potential substrates

  • Conformational Change Analysis:

    • Fluorescence resonance energy transfer (FRET) assays to detect the conformational changes associated with ATP binding and hydrolysis

    • Assessment of the mechanotransmission process by monitoring periplasmic domain movements

  • Reconstitution Studies:

    • Incorporation of purified MacB into liposomes or nanodiscs

    • Analysis of substrate transport activity in the reconstituted system

  • Interaction Analysis:

    • Surface plasmon resonance or pull-down assays to verify interaction with MacA adaptor protein

    • Analysis of tripartite complex formation with MacA and TolC components

How do researchers detect and analyze the interaction between MacB and other components of efflux systems?

The analysis of interactions between MacB and other efflux system components requires a multi-faceted approach:

  • Proteomic Analysis Techniques:
    Researchers can employ similar methods to those used in studying S. fumaroxidans cocultures, including:

    • Mass spectrometry-based proteomics to identify interacting partners

    • Quantitative proteomics to measure abundance changes in different conditions

    • Comparison of protein abundance across different growth conditions to identify co-regulated proteins

  • Genetic Approaches:

    • Construction of gene knockouts or knockdowns to assess functional impacts

    • Complementation studies with wild-type or mutant MacB variants

    • Fluorescent protein tagging for localization and interaction studies

  • Structural Biology Methods:

    • Cryo-electron microscopy of the tripartite complex

    • X-ray crystallography of component proteins and subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction interfaces

  • Biophysical Interaction Analyses:

    • Surface plasmon resonance to measure binding kinetics and affinities

    • Isothermal titration calorimetry for thermodynamic characterization

    • Analytical ultracentrifugation to study complex formation

How can researchers leverage functional genomics to study MacB in S. fumaroxidans?

The complete genome sequence of S. fumaroxidans (4,990,251 bp with 4,098 protein-coding and 81 RNA genes) provides opportunities for functional genomics approaches:

  • Comparative Genomics:

    • Identification of MacB homologs in S. fumaroxidans by comparison with characterized MacB sequences

    • Analysis of gene neighborhoods to identify potential operons containing macB and related transport components

    • Comparison with MacB homologs in other species, including the LolCDE lipoprotein trafficking complex and FtsEX cell division signaling protein

  • Transcriptomic Analysis:

    • RNA-seq to measure expression of macB under different growth conditions

    • Correlation of macB expression with other genes to identify co-regulated networks

    • Comparison of expression in pure culture versus syntrophic growth conditions

  • Systems Biology Approaches:

    • Integration of proteomic, transcriptomic, and metabolomic data to understand the role of MacB in cellular physiology

    • Metabolic flux analysis to determine how MacB-mediated transport affects cellular metabolism

    • Network analysis to position MacB within the cellular interactome

  • Genome Editing:

    • CRISPR/Cas9 or traditional homologous recombination approaches to introduce mutations or tags into the endogenous macB gene

    • Creation of reporter fusions to monitor expression and regulation

    • Construction of conditional mutants to study essential functions

What are the best approaches for analyzing data from MacB mechanotransmission studies?

Data analysis for MacB mechanotransmission studies should incorporate:

  • Time-Series Analysis:

    • Analysis of time-resolved structural changes during ATP binding and hydrolysis cycles

    • Correlation of conformational changes with functional outputs

    • Statistical methods for detecting significant state transitions

  • Molecular Dynamics Simulations:

    • In silico modeling of MacB conformational changes based on crystal structures

    • Prediction of energy landscapes for different states

    • Identification of key residues involved in mechanotransmission

  • Machine Learning Approaches:

    • Classification of conformational states from experimental data

    • Prediction of substrate specificity based on sequence and structural features

    • Feature extraction to identify patterns in large datasets from multiple experiments

  • Statistical Design Considerations:

    • Application of factorial designs to systematically test multiple variables affecting mechanotransmission

    • Response surface methodologies to optimize experimental conditions

    • Mixed effects models to account for batch-to-batch variation

How should researchers approach data contradictions in S. fumaroxidans MacB studies?

When encountering contradictory data in studies of S. fumaroxidans MacB:

  • Systematic Validation Approach:

    • Repeat experiments with varied conditions to identify context-dependent effects

    • Implement alternative methodologies to verify observations

    • Consider batch effects and ensure proper controls are in place

  • Cross-Referencing with MacB Homologs:

    • Compare findings with data from well-characterized MacB proteins in other species

    • Analyze if contradictions are specific to S. fumaroxidans or common to the MacB family

  • Metadata Analysis:

    • Examine timestamps (MAC(b) times) in research data to track when and how data was collected

    • Ensure proper documentation of experimental conditions

    • Consider time-dependent effects that might explain contradictions

  • Resolution Strategies:

    • Design critical experiments specifically addressing the contradiction

    • Implement orthogonal approaches that can resolve the contradiction

    • Consider if both contradictory results could be correct under different conditions

What emerging technologies are most promising for advancing S. fumaroxidans MacB research?

Several cutting-edge technologies hold promise for advancing research on S. fumaroxidans MacB:

  • Cryo-Electron Microscopy Advances:

    • High-resolution structural analysis of MacB in different conformational states

    • Visualization of MacB within the context of the complete tripartite pump

    • Time-resolved cryo-EM to capture transient states during mechanotransmission

  • Single-Molecule Techniques:

    • FRET-based approaches to monitor conformational changes in real-time

    • Optical tweezers to measure forces involved in mechanotransmission

    • Single-molecule tracking to observe MacB dynamics in membranes

  • Advanced Genome Editing:

    • CRISPR interference for precise regulation of macB expression

    • Base editing for introducing specific mutations without double-strand breaks

    • Scarless genome editing techniques for S. fumaroxidans

  • Microfluidic Systems:

    • Creation of stable gradients to study directional transport

    • High-throughput screening of conditions affecting MacB function

    • Integration with imaging to correlate structure and function

  • Synthetic Biology Approaches:

    • Minimal systems reconstituting MacB function in artificial membranes

    • Engineering of MacB variants with novel functionalities

    • Creation of biosensors based on MacB conformational changes

What are the potential applications of understanding S. fumaroxidans MacB in biotechnology and medicine?

Understanding S. fumaroxidans MacB could lead to several applications:

  • Antimicrobial Resistance Mitigation:

    • Development of inhibitors targeting MacB-like efflux systems to increase antibiotic efficacy

    • Design of alternative antibiotics that bypass efflux mechanisms

    • Creation of diagnostic tools to detect efflux-mediated resistance

  • Bioremediation Technologies:

    • Engineering of S. fumaroxidans or similar syntrophic bacteria for enhanced degradation of environmental pollutants

    • Optimization of syntrophic relationships for waste treatment processes

    • Design of biosensors using MacB components to detect specific contaminants

  • Bioprocessing Applications:

    • Development of anaerobic fermentation systems incorporating syntrophic relationships

    • Engineering of transport systems for efficient product secretion

    • Creation of cellular factories with optimized efflux capabilities

  • Structural Biology Insights:

    • Using the MacB mechanotransmission model to understand other membrane proteins

    • Application of structural principles to design novel molecular machines

    • Development of new experimental approaches for studying membrane protein dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.