Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
nuoA; Sfum_1943; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Target Names
nuoA
Target Protein Sequence
MQPISPDGSLSPWEPGMFSLAVYAVLVAAFVAVQLFVAWWLGERKPGVEKARPYECGIIP TGSARLRYPVPFYLVAIFFLIFDMEGAYILTWAVAFEELGWAGWLQMSFFIGLLLVGLVY VWKKGGLDWRPSYGKK
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, conserving energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Syntrophobacter fumaroxidans and why is it significant in microbial research?

Syntrophobacter fumaroxidans strain MPOB is the best-studied species of the genus Syntrophobacter. This organism holds particular interest due to its anaerobic syntrophic lifestyle and its crucial role in converting propionate to acetate, H2, and CO2 during organic matter degradation . These metabolic products serve as substrates for other microorganisms in anaerobic environments.

S. fumaroxidans displays remarkable metabolic versatility. It can ferment fumarate to CO2 and succinate in pure culture and can grow as a sulfate reducer with propionate as an electron donor . This organism belongs to the family Syntrophobacteraceae within the order Syntrophobacterales, a group of Gram-negative syntrophic propionate oxidizers that form a distinct cluster .

Genomic analysis has revealed that S. fumaroxidans possesses a larger genome (approximately 4.9 Mbp) compared to other well-studied syntrophic fatty acid degraders like Syntrophus aciditrophicus SB (3.1 Mbp) . This suggests a more complex metabolic repertoire, making it an excellent model organism for studying energy conservation mechanisms in syntrophic bacteria.

What role does the NADH-quinone oxidoreductase complex play in bacterial metabolism?

NADH-quinone oxidoreductase (Complex I) represents the first entry point into the electron transport chain in most bacteria. In S. fumaroxidans, this complex is particularly important for energy conservation under the thermodynamically challenging conditions of syntrophic growth. The complex oxidizes NADH to NAD+ while transferring electrons to quinones in the membrane, coupled with proton translocation across the membrane that contributes to the proton motive force for ATP synthesis.

In syntrophic bacteria like S. fumaroxidans, which operate near thermodynamic limits, the efficiency of electron transport chain components is critical. The nuo complex likely plays a crucial role in allowing S. fumaroxidans to grow syntrophically with methanogenic partners by maximizing energy conservation from limited free energy available during syntrophic metabolism.

How does the genome structure of S. fumaroxidans inform its metabolic capabilities?

The complete genome sequence of S. fumaroxidans provides valuable insights into its metabolic versatility. The genome contains two nearly identical 16S rRNA gene sequences (differing by only 2 bp) , which is a notable feature for understanding its evolutionary history and transcriptional regulation.

When compared with other microorganisms, S. fumaroxidans shows closest genomic associations to Desulfobacterium autotrophicum HRM2 (1593 reciprocal gene hits), Desulfatibacillum alkenivorans AK-01 (1551), and Desulfobacterium autotrophicum RS-1 (1448) . This genomic similarity to sulfate-reducing bacteria aligns with its ability to grow as a sulfate reducer.

The evolutionary relationship between sulfate reduction and syntrophic metabolism is evident in the genomes of Syntrophobacterales, which contain both dedicated sulfate reducers and syntrophic species that retain sulfate-reducing genes . This suggests an evolutionary connection between these metabolic capabilities, with S. fumaroxidans representing an organism that has maintained both lifestyles.

What NIH guidelines apply to research involving recombinant S. fumaroxidans nuoA?

Research involving recombinant S. fumaroxidans nuoA falls under the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. These guidelines define recombinant nucleic acids as "molecules that are constructed by joining nucleic acid molecules and can replicate in a living cell" . The guidelines were amended to include synthetic nucleic acids, defined as "nucleic acid molecules that are chemically or by other means synthesized or amplified, including those that are chemically or otherwise modified but can base pair with naturally occurring nucleic acid molecules" .

All institutions receiving NIH funding for any recombinant or synthetic nucleic acid research must comply with these guidelines, unless specifically exempted . This means that even if your specific nuoA project is not NIH-funded, your institution must follow these guidelines if it receives any NIH funding for recombinant DNA research.

What institutional oversight is required for recombinant nuoA research?

Institutional Biosafety Committee (IBC) review is required for recombinant DNA protocols, including those involving nuoA . The IBC is responsible for:

  • Reviewing research protocols for compliance with NIH Guidelines

  • Assessing risk and determining appropriate containment levels

  • Ensuring proper training of research personnel

  • Periodic review of ongoing research

The IBC must review both recombinant DNA research and research involving synthetic nucleic acids . The committee's approval must be obtained before initiating research with recombinant S. fumaroxidans nuoA.

How do the NIH Guidelines define and regulate synthetic nucleic acid research?

The NIH Guidelines define synthetic nucleic acids as "nucleic acid molecules that are chemically or by other means synthesized or amplified, including those that are chemically or otherwise modified but can base pair with naturally occurring nucleic acid molecules" . This definition encompasses:

  • Chemically synthesized gene fragments

  • PCR-amplified sequences

  • Modified nucleic acids that can base pair with natural nucleic acids

  • Synthetic genes created through gene synthesis technologies

Research involving synthetic S. fumaroxidans nuoA would fall under these guidelines. It's important to note that research with synthetic nucleic acids does not need to also involve recombinant techniques to be subject to the NIH Guidelines . Either recombinant or synthetic work independently triggers compliance requirements.

What are key considerations for designing transcriptomic experiments involving nuoA?

When designing transcriptomic experiments to study nuoA expression, researchers should consider several critical factors based on established principles of experimental design for genomic research :

How should researchers approach sample size determination for nuoA expression studies?

Sample size determination for nuoA expression studies requires balancing statistical power with practical constraints. Key approaches include:

  • Power Calculations: While desirable for experimental design, power calculations may be limited by uncertainties about variability in assays and study populations . When possible, conduct pilot studies to estimate variability and inform formal power analysis.

  • Minimum Replication Guidelines:

    • For qRT-PCR studies: Minimum of 3-5 biological replicates with 2-3 technical replicates each

    • For RNA-seq: At least 3 biological replicates per condition, with more recommended for detecting subtle effects

    • For proteomics: 4-6 biological replicates due to higher variability

  • Consideration of Effect Sizes: Larger sample sizes are needed to detect small differences in expression. Based on preliminary data or literature, estimate the expected fold change in nuoA expression under your experimental conditions.

  • Biological vs. Technical Replication: Prioritize biological replicates (independent cultures or samples) over technical replicates (repeated measurements of the same sample) as they capture the true biological variation of interest .

Study TypeMinimum Biological ReplicatesRecommended Biological ReplicatesTechnical Replicates
qRT-PCR35-62-3
RNA-seq36-121-2
Microarray48-101-2
Proteomics46-102-3

What data analysis approaches are most appropriate for nuoA transcriptomic data?

Analysis of nuoA transcriptomic data requires a methodological approach tailored to the experimental design and research questions. Based on established practices in genomic data analysis , appropriate approaches include:

  • Normalization Methods:

    • For RNA-seq: TPM (Transcripts Per Million) or RPKM/FPKM normalization

    • For microarrays: RMA (Robust Multi-array Average) or quantile normalization

    • For qRT-PCR: Normalization to stable reference genes selected using algorithms like geNorm or NormFinder

  • Differential Expression Analysis:

    • For RNA-seq: DESeq2, edgeR, or limma-voom

    • For microarrays: limma or SAM (Significance Analysis of Microarrays)

    • For multiple comparisons: Apply appropriate correction methods (e.g., Benjamini-Hochberg procedure)

  • Pattern Recognition Approaches:

    • Unsupervised clustering methods like hierarchical clustering or k-means clustering to identify co-expression patterns

    • Principal component analysis (PCA) to visualize major sources of variation in the data

    • Self-organizing maps or force-directed layouts for visualization of complex relationships

  • Contextual Analysis:

    • Pathway analysis to place nuoA expression changes in broader metabolic context

    • Gene set enrichment analysis to identify biological processes associated with nuoA regulation

    • Correlation network analysis to identify genes with expression patterns similar to nuoA

These approaches should be applied systematically, with careful attention to the assumptions underlying each method and appropriate validation of key findings.

What methodologies are most effective for studying nuoA protein function?

Functional characterization of nuoA protein requires specialized approaches due to its membrane-associated nature and role in the NADH-quinone oxidoreductase complex. Effective methodologies include:

  • Genetic Manipulation Approaches:

    • Gene deletion/knockout to assess essentiality and phenotypic effects

    • Site-directed mutagenesis of conserved residues to probe structure-function relationships

    • Complementation studies to confirm specificity of observed phenotypes

    • Conditional expression systems to study effects of varied expression levels

  • Biochemical Characterization:

    • Enzyme activity assays measuring NADH oxidation rates

    • Membrane potential measurements using fluorescent probes

    • Proton translocation assays to assess coupling efficiency

    • Electron paramagnetic resonance (EPR) spectroscopy to study redox centers

  • Interaction Studies:

    • Co-immunoprecipitation with other nuo subunits

    • Crosslinking mass spectrometry to map interaction interfaces

    • Blue native PAGE to assess complex formation and stability

    • Förster resonance energy transfer (FRET) to study dynamic interactions

  • Structural Studies:

    • Cryo-electron microscopy of the intact complex

    • X-ray crystallography of purified protein or subcomplex

    • NMR studies of specific domains or interactions

    • Molecular dynamics simulations based on structural data

Each methodology provides different but complementary insights into nuoA function, and combining multiple approaches yields the most comprehensive understanding.

How can researchers address challenges in membrane protein expression for nuoA studies?

Recombinant expression of membrane proteins like nuoA presents significant challenges. Based on established practices in membrane protein research, effective strategies include:

  • Expression System Selection:

    • E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Cell-free expression systems that allow addition of detergents or lipids during synthesis

    • Homologous expression in S. fumaroxidans for native-like membrane environment (technically challenging)

    • Pseudomonas species as alternative hosts with similar membrane composition

  • Expression Optimization:

    • Codon optimization for the selected host organism

    • Lower temperature expression (16-25°C) to slow synthesis and improve folding

    • Induction optimization (concentration and timing)

    • Co-expression with chaperones to assist folding

  • Fusion Strategies:

    • N- or C-terminal fusion with solubility-enhancing tags (MBP, SUMO)

    • Addition of purification tags (His, Strep) at positions that don't interfere with folding

    • Cleavable tags for post-purification removal

    • Split-GFP complementation to monitor proper membrane insertion

  • Extraction and Purification Approaches:

    • Detergent screening to identify optimal solubilization conditions

    • Native nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for detergent-free extraction

    • Affinity chromatography followed by size exclusion chromatography

    • Quality assessment using multiple techniques (CD spectroscopy, thermal stability assays)

  • Co-expression Strategies:

    • Co-expression with interacting nuo subunits to stabilize the protein

    • Sequential purification to isolate intact subcomplexes

    • Validation of complex formation by analytical ultracentrifugation or native PAGE

These strategies should be systematically evaluated for each specific research application involving nuoA.

What analytical techniques are appropriate for studying electron transport involving nuoA?

Studying electron transport processes involving nuoA requires specialized analytical techniques that can probe redox reactions, electron flow, and energy coupling. Appropriate techniques include:

  • Spectroscopic Methods:

    • UV-visible spectroscopy to monitor redox state changes

    • Fluorescence spectroscopy with redox-sensitive probes

    • Electron paramagnetic resonance (EPR) spectroscopy to characterize iron-sulfur clusters

    • Resonance Raman spectroscopy to study structural changes during electron transfer

  • Electrochemical Techniques:

    • Protein film voltammetry to measure redox potentials

    • Chronoamperometry to study electron transfer kinetics

    • Membrane-modified electrodes to study membrane-associated electron transport

    • Mediated electrochemistry for complex reaction analysis

  • Bioenergetic Measurements:

    • Oxygen consumption measurements using high-resolution respirometry

    • Membrane potential assays using potential-sensitive dyes

    • pH monitoring for proton translocation studies

    • ATP synthesis coupling measurements

  • Real-time Monitoring:

    • Stopped-flow spectroscopy for rapid reaction kinetics

    • Freeze-quench techniques combined with EPR for intermediate capture

    • Time-resolved fluorescence for conformational dynamics

    • Single-molecule techniques for heterogeneity analysis

  • Comparative Analysis:

    • Wild-type vs. nuoA mutant comparisons under different electron donor/acceptor conditions

    • Activity measurements across a range of substrate concentrations for kinetic parameter determination

    • Inhibitor studies to probe mechanism and binding sites

    • Temperature and pH dependence to investigate thermodynamic parameters

How can evolutionary analysis of nuoA inform understanding of syntrophic metabolism?

Evolutionary analysis of nuoA can provide profound insights into the adaptation of S. fumaroxidans to syntrophic lifestyle. Key approaches include:

  • Comparative Sequence Analysis:

    • Multiple sequence alignment of nuoA across diverse bacteria

    • Identification of conserved residues specific to syntrophic bacteria

    • Positive selection analysis to identify residues under adaptive evolution

    • Ancestral sequence reconstruction to infer evolutionary trajectory

  • Phylogenetic Analysis:

    • Construction of nuoA phylogenetic trees compared to species trees

    • Analysis of horizontal gene transfer events in nuoA evolution

    • Correlation of nuoA sequence features with syntrophic capabilities

    • Dating key evolutionary events using molecular clock approaches

  • Structural Evolution:

    • Homology modeling of nuoA from diverse species

    • Mapping of sequence conservation onto structural models

    • Analysis of co-evolution between structurally interacting residues

    • Identification of structural adaptations specific to syntrophic species

S. fumaroxidans belongs to the order Syntrophobacterales, which shows an evolutionary connection between sulfate-reducing and syntrophic lifestyles . The distribution of sulfate reduction genes (like dsrAB) among syntrophic and non-syntrophic members of this order suggests that syntrophic metabolism likely evolved from sulfate-reducing ancestors .

Evolutionary analysis can reveal whether nuoA has undergone specific adaptations to support the energetic challenges of syntrophic growth, potentially identifying key innovations that enabled this metabolic lifestyle.

What research approaches can link nuoA function to broader metabolic networks in S. fumaroxidans?

Integrating nuoA function into broader metabolic networks requires multi-faceted approaches that connect molecular-level processes to cellular physiology:

  • Systems Biology Approaches:

    • Genome-scale metabolic modeling incorporating nuoA function

    • Flux balance analysis to predict metabolic rerouting in nuoA mutants

    • 13C metabolic flux analysis to measure in vivo pathway activities

    • Integration of transcriptomic, proteomic, and metabolomic data

  • Multi-omics Integration:

    • Correlation of nuoA expression with global transcriptomic changes

    • Proteomic analysis of protein complex remodeling in response to nuoA perturbation

    • Metabolomic profiling to identify metabolite changes linked to nuoA function

    • Network analysis to identify regulatory hubs connected to nuoA

  • Physiological Measurements:

    • Growth kinetics under different electron donor/acceptor combinations

    • Syntrophic co-culture experiments with methanogenic partners

    • Thermodynamic analysis of energy conservation efficiency

    • Redox balance measurements across metabolic states

  • Perturbation Studies:

    • Response to electron transport inhibitors targeting different complexes

    • Adaptation to different energy limitations

    • Synthetic lethality screening to identify genetic interactions

    • Controlled environmental shifts to probe metabolic flexibility

How can research on S. fumaroxidans nuoA contribute to biotechnological applications?

Research on S. fumaroxidans nuoA has potential applications in several biotechnological areas:

  • Bioenergy Production:

    • Optimizing syntrophic consortia for biogas production from organic waste

    • Engineering more efficient electron transfer pathways for bioenergy applications

    • Developing microbial fuel cells utilizing syntrophic partnerships

    • Improving anaerobic digestion processes through better understanding of energy conservation

  • Environmental Bioremediation:

    • Designing synthetic consortia for degradation of recalcitrant compounds

    • Optimizing electron flow for more efficient pollutant transformation

    • Bioaugmentation strategies targeting energy-limited environments

    • Monitoring tools based on nuoA expression as indicators of syntrophic activity

  • Synthetic Biology Applications:

    • Creating minimal synthetic pathways for energy conservation

    • Engineering artificial electron transport chains with optimized properties

    • Developing tunable syntrophic relationships for controlled fermentations

    • Designing switch mechanisms based on energy metabolism regulation

  • Biotechnological Process Improvement:

    • Enhancing stability and resilience of industrial bioprocesses

    • Developing strategies to overcome thermodynamic limitations

    • Creating biosensors for monitoring energy metabolism in real-time

    • Optimizing nutrient recovery from waste streams through syntrophic processes

Understanding the molecular details of nuoA function in S. fumaroxidans could enable rational design of more efficient microbial consortia for these applications, particularly where energy conservation under thermodynamic constraints is a limiting factor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.