Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 1 (nuoK1)

What is Syntrophobacter fumaroxidans and why is it significant in microbial research?

• Grow syntrophically with methanogens like Methanospirillum hungatei

• Grow as a sulfate reducer with propionate as an electron donor

• Ferment fumarate in pure culture to CO2 and succinate

Its genome is 4,990,251 bp long with 4,098 protein-coding and 81 RNA genes, making it a rich subject for genomic and proteomic studies .

What is NADH-quinone oxidoreductase subunit K 1 (nuoK1) in S. fumaroxidans?

NADH-quinone oxidoreductase subunit K 1 (nuoK1) is a membrane protein encoded by the nuoK1 gene (locus Sfum_0206) in Syntrophobacter fumaroxidans . This protein:

• Is also known as NADH dehydrogenase I subunit K 1 or NDH-1 subunit K 1

• Has the enzyme classification number EC 1.6.99.5

• Has a UniProt accession number A0LEQ5

• Contains 102 amino acids in its full sequence

• Consists of the amino acid sequence: MNTLTTYLVIAAVLFCLGLGLILQRRNLVGMLISLELMLNGANLN­FMAFNRFLAPEPAVGQIIALIVMGLAAAEAAIGLSIIFALFRRMHSINVERAQELRG

The protein likely functions as part of the NADH dehydrogenase complex, which is involved in electron transport and energy conservation mechanisms.

What energy conservation mechanisms does S. fumaroxidans employ, and how does nuoK1 fit into these systems?

S. fumaroxidans employs several sophisticated energy conservation mechanisms:

• Electron confurcation/bifurcation: Formate dehydrogenase Fdh1 and hydrogenase Hox are the main confurcating enzymes used for energy conservation .

• Reverse electron transport (RET): In the periplasm, Fdh2 and hydrogenase Hyn play important roles in reverse electron transport associated with succinate oxidation .

• Interspecies electron transfer (IET): Periplasmic Fdh3 and Fdh5 are involved in interspecies electron transfer, particularly when growing syntrophically with methanogens .

• Menaquinone-mediated electron transport: The oxidation of succinate via menaquinone is highly endergonic and requires a transmembrane proton gradient to function .

The nuoK1 protein, as part of the NADH-quinone oxidoreductase complex, likely contributes to these energy conservation mechanisms by participating in the electron transport chain. NADH dehydrogenase complexes typically couple the oxidation of NADH to the reduction of quinones while pumping protons across the membrane, thus contributing to the proton motive force necessary for ATP synthesis .

How does the expression of nuoK1 differ across various growth conditions of S. fumaroxidans, and what methodologies are most effective for studying these expression patterns?

The expression of nuoK1 in S. fumaroxidans varies based on growth conditions, particularly when comparing axenic growth versus syntrophic growth. Based on proteome analyses of S. fumaroxidans under different growth conditions:

Expression patterns:

• When growing on propionate with sulfate or fumarate as electron acceptors, energy conservation systems including NADH dehydrogenase complexes show distinct expression patterns compared to syntrophic growth .

• In syntrophic growth with methanogens (M. hungatei or M. formicicum) or other sulfate-reducing bacteria (D. desulfuricans), the expression of electron transport components is regulated to facilitate interspecies electron transfer .

Recommended methodologies for studying expression patterns:

• Quantitative proteomics: LC-MS/MS-based proteomics approaches have been successfully used to compare protein abundances across different growth conditions . This approach allows for:

  • Identification of differentially expressed proteins

  • Quantification of fold changes in protein abundance

  • Statistical analysis of significant differences

• Transcriptomics: RNA-seq or microarray analysis can provide insights into transcriptional regulation of nuoK1 and related genes .

• Blue native PAGE: For studying intact membrane protein complexes like NADH dehydrogenase that contain nuoK1 .

• Targeted protein expression analysis: Western blotting with antibodies specific to nuoK1 or epitope-tagged recombinant versions.

• In situ localization: Immunogold electron microscopy to determine the subcellular localization of nuoK1 under different growth conditions.

When designing experiments to study nuoK1 expression, researchers should consider:

• Careful standardization of growth conditions

• Inclusion of appropriate controls

• Multiple biological replicates

• Validation of results using complementary methods

What challenges exist in expressing and purifying functional recombinant nuoK1 from S. fumaroxidans, and what strategies can overcome these limitations?

Challenges in expressing and purifying functional recombinant nuoK1:

• Membrane protein solubility: As a membrane protein (evident from its sequence containing hydrophobic transmembrane segments), nuoK1 presents solubility challenges during expression and purification .

• Maintaining native conformation: Ensuring the recombinant protein maintains its native conformation and activity is challenging, as it normally functions as part of a multi-subunit complex.

• Expression host compatibility: Selecting an appropriate expression host that can properly fold and process bacterial membrane proteins.

• Post-translational modifications: Ensuring any necessary post-translational modifications are correctly performed.

• Stability during purification: Membrane proteins often have stability issues when removed from their lipid environment.

Recommended strategies:

• Expression system selection:

  • E. coli-based systems optimized for membrane proteins (e.g., C41/C43 strains, Lemo21)

  • Cell-free expression systems that allow for the direct incorporation of detergents or lipids

  • Homologous expression in closely related bacteria if heterologous expression fails

• Fusion tags and constructs:

  • Use of solubility-enhancing fusion partners (MBP, SUMO, Trx)

  • Addition of affinity tags (His, FLAG, Strep) for purification

  • Careful design of constructs to maintain functional domains

• Solubilization and purification strategies:

  • Screening of multiple detergents (mild non-ionic detergents like DDM, LMNG)

  • Use of lipid nanodiscs or amphipols for stabilization

  • Gentle purification conditions (buffered pH, inclusion of glycerol)

  • Purification in the presence of other subunits to maintain complex integrity

• Functional validation:

  • Activity assays to confirm that the purified protein retains functionality

  • Structural characterization to confirm proper folding

• Co-expression approaches:

  • Consider co-expressing nuoK1 with interacting subunits of the NADH dehydrogenase complex to improve stability and folding

How does the structure and function of nuoK1 in S. fumaroxidans compare with homologous proteins in other bacteria, and what methodological approaches can elucidate these relationships?

Comparative analysis of nuoK1 structure and function:

The nuoK1 protein in S. fumaroxidans is part of the NADH:quinone oxidoreductase (Complex I) family. Comparing it with homologous proteins from other bacteria reveals insights into its structure-function relationships:

Methodological approaches for comparative analysis:

• Sequence-based approaches:

  • Multiple sequence alignment to identify conserved residues

  • Phylogenetic analysis to determine evolutionary relationships

  • Protein domain prediction to identify functional modules

• Structural biology methods:

  • Homology modeling based on resolved structures of bacterial Complex I

  • X-ray crystallography of the purified protein or complex

  • Cryo-electron microscopy for structural determination of the entire complex

• Functional characterization:

  • Site-directed mutagenesis of conserved residues to assess functional importance

  • Complementation studies in knockout mutants

  • Electron paramagnetic resonance (EPR) spectroscopy to study electron transfer mechanisms

• Computational approaches:

  • Molecular dynamics simulations to study protein dynamics

  • Quantum mechanical calculations for electron transfer properties

  • Systems biology modeling of respiratory chain function

• Cross-species complementation:

  • Expression of S. fumaroxidans nuoK1 in other bacterial species with nuoK deletions to test functional conservation

These comparative studies can provide insights into how nuoK1 has evolved in S. fumaroxidans to support its unique syntrophic lifestyle and energy conservation mechanisms.

What is the role of nuoK1 in the syntrophic interactions of S. fumaroxidans, and how can researchers effectively study these interactions?

Role of nuoK1 in syntrophic interactions:

The nuoK1 protein, as part of the NADH dehydrogenase complex, likely plays a significant role in the energy conservation systems that enable S. fumaroxidans to engage in syntrophic relationships. In syntrophic interactions:

• S. fumaroxidans oxidizes propionate to acetate, CO2, and H2/formate, which requires tight coupling of energetically unfavorable reactions with energy-yielding reactions .

• The NADH dehydrogenase complex containing nuoK1 may participate in:

  • Reverse electron transport to drive the energetically unfavorable oxidation of succinate to fumarate

  • Contributing to the proton motive force needed for ATP synthesis

  • Electron transfer chains that ultimately produce hydrogen or formate for interspecies electron transfer

• Proteome analyses suggest that electron transfer components, including NADH dehydrogenase complexes, are regulated differently in syntrophic growth conditions compared to axenic growth .

Methodologies for studying syntrophic interactions involving nuoK1:

• Co-culture systems:

  • Defined co-cultures of S. fumaroxidans with methanogens (M. hungatei, M. formicicum) or sulfate reducers (D. desulfuricans)

  • Continuous culture systems to maintain steady-state syntrophic growth

  • Monitoring of metabolite fluxes (propionate, acetate, H2, formate)

• Genetic approaches:

  • Gene knockout or knockdown of nuoK1 to assess its importance in syntrophy

  • Complementation studies with wild-type or mutated nuoK1

  • Fluorescent tagging for localization studies

• Biochemical and biophysical techniques:

  • Membrane vesicle preparations to study electron transport

  • Proton translocation assays to measure proton pumping activity

  • Activity assays for NADH dehydrogenase in different growth conditions

• -Omics approaches:

  • Comparative proteomics of S. fumaroxidans grown in different syntrophic partnerships

  • Transcriptomics to identify co-regulated genes

  • Metabolomics to track metabolic fluxes during syntrophic growth

• Microscopy techniques:

  • Fluorescence microscopy to visualize spatial organization in syntrophic cultures

  • Electron microscopy to study cell-cell interactions

  • FISH probes to monitor species distribution in co-cultures

These methods can help elucidate the specific contribution of nuoK1 to the syntrophic lifestyle of S. fumaroxidans and provide insights into the fundamental mechanisms of interspecies electron transfer in anaerobic microbial communities.

How can researchers effectively use recombinant nuoK1 for studying electron transport mechanisms in S. fumaroxidans?

Applications of recombinant nuoK1 in electron transport research:

Recombinant nuoK1 protein can serve as a valuable tool for investigating the electron transport mechanisms in S. fumaroxidans, particularly focusing on:

• Structure-function relationships in NADH dehydrogenase complex

• Protein-protein interactions within respiratory complexes

• Mechanism of proton translocation coupled to electron transfer

• Role in reverse electron transport during syntrophic growth

Methodological approaches:

• Reconstitution studies:

  • Purified recombinant nuoK1 can be reconstituted into liposomes or nanodiscs with other subunits of the NADH dehydrogenase complex

  • Activity measurements of reconstituted complexes can help determine the minimal functional unit

  • Protocol: Express tagged recombinant nuoK1, purify using affinity chromatography, reconstitute with lipids and additional subunits, and measure NADH dehydrogenase activity

• Interaction mapping:

  • Pull-down assays using tagged recombinant nuoK1 to identify interaction partners

  • Cross-linking studies followed by mass spectrometry (XL-MS) to map protein-protein interactions

  • Microscale thermophoresis or surface plasmon resonance to measure binding affinities

• Mutational analysis:

  • Site-directed mutagenesis of conserved residues in recombinant nuoK1

  • Expression of mutant proteins in native or heterologous hosts

  • Functional assays to determine effects on electron transport and proton translocation

• Structural studies:

  • X-ray crystallography or cryo-EM of complexes containing recombinant nuoK1

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

  • Computational modeling based on experimental structural data

• Electron transfer kinetics:

  • Stopped-flow spectroscopy with recombinant nuoK1-containing complexes

  • Measurement of electron transfer rates using artificial electron donors/acceptors

  • EPR spectroscopy to track electron movement through redox centers

Experimental design considerations:

When designing experiments with recombinant nuoK1, researchers should:

• Ensure the recombinant protein retains native conformation and functionality

• Consider the membrane environment necessary for proper function

• Include appropriate controls for non-specific effects

• Validate findings in whole-cell systems where possible

• Consider the multi-subunit nature of the native complex

What are the implications of nuoK1 research for understanding bioenergetics in syntrophic communities, and what future research directions are most promising?

Implications of nuoK1 research for understanding bioenergetics:

Research on nuoK1 and related components of energy conservation systems in S. fumaroxidans has significant implications for:

• Fundamental bioenergetics: Elucidating the mechanisms by which organisms conserve energy at the thermodynamic limit of life, particularly through electron bifurcation/confurcation and reverse electron transport .

• Syntrophic interactions: Understanding how energy-limited syntrophic partners coordinate their metabolism through interspecies electron transfer .

• Anaerobic food webs: Clarifying the role of propionate-oxidizing syntrophs in anaerobic environments and their contribution to global carbon cycling .

• Metabolic versatility: Revealing how organisms like S. fumaroxidans adapt their metabolism to different electron acceptors and growth conditions .

Promising future research directions:

• Systems biology approaches:

  • Genome-scale metabolic modeling of S. fumaroxidans to predict metabolic fluxes under different conditions

  • Integration of proteomic, transcriptomic, and metabolomic data to build comprehensive models of energy conservation

  • Flux balance analysis to identify key control points in syntrophic metabolism

• Advanced imaging and single-cell techniques:

  • Super-resolution microscopy to visualize the spatial organization of respiratory complexes

  • Single-cell proteomics to investigate cell-to-cell variability in syntrophic populations

  • Live-cell imaging of fluorescently tagged nuoK1 and other components

• Synthetic biology applications:

  • Engineering optimized syntrophic consortia for biotechnological applications

  • Creating minimal syntrophic systems to study fundamental principles

  • Developing biosensors based on syntrophic interactions for environmental monitoring

• Evolutionary perspectives:

  • Comparative genomics across diverse syntrophic organisms to identify convergent adaptations

  • Experimental evolution studies to observe adaptation to syntrophic lifestyle

  • Reconstruction of ancestral proteins to understand the evolution of energy conservation mechanisms

• Environmental and applied research:

  • Investigation of syntrophic communities in natural environments and engineered systems

  • Development of strategies to enhance syntrophic conversions in anaerobic digesters

  • Exploration of syntrophic interactions as targets for modulating microbial communities

Research roadmap:

• Molecular characterization of nuoK1 and related components

• Integration into whole-cell models of energy conservation

• Validation in defined syntrophic communities

• Application to complex environmental systems

• Development of biotechnological applications

By pursuing these research directions, scientists can advance our understanding of the fundamental bioenergetic principles that underlie syntrophic interactions and their importance in anaerobic ecosystems.

What are common challenges in experimental studies involving recombinant nuoK1, and how can researchers address them?

Common challenges and solutions in recombinant nuoK1 research:

Technical recommendations:

• Expression optimization:

  • Test multiple expression systems (E. coli, yeast, insect cells)

  • Optimize induction conditions through factorial design experiments

  • Consider cell-free expression systems for toxic membrane proteins

• Purification strategies:

  • Begin with mild solubilization using detergents like DDM or LMNG

  • Implement two-step purification (e.g., affinity chromatography followed by size exclusion)

  • Include stabilizers throughout purification (glycerol, specific lipids)

• Quality control:

  • Verify protein identity by mass spectrometry

  • Assess purity by SDS-PAGE and Western blotting

  • Confirm proper folding by circular dichroism or fluorescence spectroscopy

  • Evaluate oligomeric state by size exclusion chromatography

• Functional validation:

  • Develop reliable activity assays appropriate for NADH dehydrogenase function

  • Compare activity with native protein complexes where possible

  • Assess membrane incorporation using fluorescence or EPR techniques

How can researchers integrate studies of nuoK1 with broader investigations of S. fumaroxidans metabolism and syntrophic interactions?

Integration strategies for nuoK1 research in broader metabolic studies:

Methodological integration framework:

• Experimental design phase:

  • Define clear hypotheses about nuoK1's role in specific metabolic contexts

  • Design experiments with appropriate controls and multiple analytical endpoints

  • Plan for integration of data from different methodological approaches

• Data collection phase:

  • Standardize sampling procedures across experimental conditions

  • Collect data at multiple levels (molecular, cellular, community)

  • Ensure technical reproducibility through appropriate replication

• Data integration phase:

  • Develop computational pipelines for integrating heterogeneous data types

  • Apply statistical methods appropriate for multi-omics data integration

  • Visualize integrated datasets to identify patterns and correlations

• Validation phase:

  • Test model predictions with targeted experiments

  • Verify key findings using orthogonal methods

  • Assess biological relevance in environmental or applied contexts

How might functional studies of nuoK1 contribute to our understanding of electron confurcation mechanisms in anaerobic bacteria?

Potential contributions of nuoK1 research to understanding electron confurcation:

Electron confurcation (the reverse of electron bifurcation) is a recently discovered mechanism for energy conservation in anaerobic organisms. Studies of nuoK1 and associated NADH dehydrogenase complexes in S. fumaroxidans could significantly advance our understanding of these mechanisms:

• Mechanistic insights:

  • The NADH dehydrogenase complex containing nuoK1 may participate in confurcating mechanisms that couple energetically favorable and unfavorable reactions

  • Functional studies could reveal how electrons flow through these complexes and how this flow is coupled to proton translocation

  • Structural analysis of nuoK1-containing complexes could identify features that enable confurcation

• Energy conservation efficiency:

  • Quantitative analysis of energy conservation through nuoK1-associated pathways

  • Thermodynamic modeling of electron flows in confurcating systems

  • Comparison of ATP yields in different growth conditions

• Evolutionary adaptations:

  • Comparative analysis of nuoK1 and related proteins across diverse anaerobes

  • Identification of structural features that enable confurcating electron transfer

  • Reconstruction of the evolutionary history of confurcation mechanisms

Experimental approaches:

• Biochemical characterization:

  • Reconstitution of purified nuoK1 with other subunits to recreate confurcating complexes

  • Measurement of electron transfer rates with different electron donors and acceptors

  • Determination of midpoint potentials of electron carriers in the complex

• Structural studies:

  • Cryo-EM structures of intact NADH dehydrogenase complexes containing nuoK1

  • Identification of cofactor arrangement and electron transfer pathways

  • Computational modeling of electron tunneling pathways

• Genetic manipulation:

  • Site-directed mutagenesis of key residues in nuoK1

  • Creation of chimeric proteins to test domain-specific functions

  • In vivo analysis of mutant phenotypes under different growth conditions

• Advanced spectroscopic techniques:

  • Electron paramagnetic resonance (EPR) to track unpaired electrons

  • Transient absorption spectroscopy to measure electron transfer kinetics

  • Raman spectroscopy to probe structural changes during catalysis

What novel biotechnological applications might emerge from research on S. fumaroxidans nuoK1 and related energy conservation mechanisms?

Potential biotechnological applications:

Research on nuoK1 and related energy conservation mechanisms in S. fumaroxidans could inspire several innovative biotechnological applications:

• Enhanced biogas production:

  • Engineering syntrophic consortia with optimized electron transfer capabilities for anaerobic digestion systems

  • Improving propionate degradation in biogas reactors, a common rate-limiting step

  • Developing monitoring tools for syntrophic populations in anaerobic digesters

• Bioremediation technologies:

  • Designing syntrophic consortia for degradation of recalcitrant pollutants

  • Enhancing microbial activity in low-energy environments

  • Creating biosensors based on syntrophic interactions for monitoring environmental contaminants

• Microbial electrosynthesis:

  • Adapting S. fumaroxidans electron transfer mechanisms for extracellular electron transfer in bioelectrochemical systems

  • Engineering synthetic electron transport chains incorporating nuoK1-like components

  • Developing novel electrode materials that interface with biological electron transport systems

• Bioenergy applications:

  • Design of artificial enzyme cascades based on confurcating mechanisms

  • Engineering microorganisms with enhanced hydrogen or formate production capabilities

  • Development of novel biocatalysts for energy conversion processes

• Synthetic biology tools:

  • Creation of genetic modules for energy conservation that can be transferred to other organisms

  • Development of tunable electron transfer systems for synthetic biology applications

  • Design of orthogonal redox systems for new-to-nature metabolic pathways

Research-to-application pathway:

• Fundamental understanding phase:

  • Detailed characterization of nuoK1 structure and function

  • Elucidation of molecular mechanisms of electron confurcation

  • Identification of rate-limiting steps in syntrophic metabolism

• Proof-of-concept phase:

  • Laboratory-scale demonstrations of enhanced syntrophic processes

  • Engineering of model organisms with improved electron transfer capabilities

  • Development of prototype bioelectrochemical systems

• Application development phase:

  • Scale-up of promising technologies

  • Optimization for specific industrial contexts

  • Field testing under relevant conditions

• Implementation and commercialization phase:

  • Process integration into existing industrial systems

  • Economic and life cycle assessment

  • Regulatory approval and commercialization

These biotechnological applications represent the potential translation of fundamental research on nuoK1 and related energy conservation mechanisms into practical solutions for environmental and energy challenges.

How might the study of nuoK1 and related energy conservation systems in S. fumaroxidans advance our broader understanding of microbial communities in anaerobic environments?

Research on nuoK1 and related energy conservation systems in S. fumaroxidans has the potential to significantly advance our understanding of anaerobic microbial communities in several key ways:

• Fundamental ecological principles:

  • Elucidating the molecular basis of syntrophic interactions that form the foundation of anaerobic food webs

  • Understanding how thermodynamic constraints shape microbial community structure and function

  • Revealing mechanisms that enable life at the bioenergetic limits

• Ecosystem processes:

  • Clarifying the rates and regulation of carbon cycling in anaerobic environments

  • Understanding methane production dynamics in natural and engineered systems

  • Identifying bottlenecks in organic matter degradation pathways

• Community interactions:

  • Revealing principles of metabolic complementarity and specialization

  • Understanding how electron transfer mechanisms enable interspecies cooperation

  • Identifying keystone functions in anaerobic communities

• Environmental adaptation:

  • Understanding how energy conservation systems adapt to different environmental conditions

  • Identifying molecular signatures of syntrophic capacity in environmental samples

  • Predicting community responses to perturbations based on metabolic capabilities

Future research directions: