Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Description

Fundamental Characterization of Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2 (nuoK2)

NADH-quinone oxidoreductase subunit K 2 (nuoK2) from Syntrophobacter fumaroxidans is a protein encoded by the nuoK2 gene (Sfum_1938) within the genome of this anaerobic bacterium. This protein represents a critical component of the NADH-quinone oxidoreductase complex, also known as NADH dehydrogenase I or NDH-1, which serves as an essential element in the respiratory chain of numerous organisms. The recombinant form of this protein is produced through genetic engineering techniques to facilitate its study and application in various research contexts .

The nuoK2 protein is officially classified under Enzyme Commission (EC) number 1.6.99.5, indicating its enzymatic role as an NADH-quinone oxidoreductase. It participates in the transfer of electrons from NADH to quinones, a process fundamental to energy metabolism within the bacterial cell. The protein consists of 114 amino acids with a specific sequence that defines its structure and functional capabilities .

Table 1: Basic Properties of Recombinant Syntrophobacter fumaroxidans nuoK2

PropertyDescription
Protein NameNADH-quinone oxidoreductase subunit K 2
Alternative NamesNADH dehydrogenase I subunit K 2, NDH-1 subunit K 2
EC Number1.6.99.5
Gene NamenuoK2
Ordered Locus NameSfum_1938
Expression Region1-114
UniProt AccessionA0LJM1
Commercial Quantity50 μg (other quantities available upon request)
Storage BufferTris-based buffer, 50% glycerol, optimized for protein stability
Storage Conditions-20°C for regular storage; -20°C to -80°C for extended storage

Taxonomic and Biological Context of Syntrophobacter fumaroxidans

Syntrophobacter fumaroxidans represents a fascinating species of bacteria with distinctive metabolic capabilities that enable it to thrive in anaerobic environments. Its proper taxonomic classification places it within the domain Bacteria, phylum Thermodesulfobacteriota, class Syntrophobacteria, order Syntrophobacterales, family Syntrophobacteraceae, and genus Syntrophobacter. The type strain of this species is MPOB, also designated as DSM 10017 in culture collections .

A defining characteristic of Syntrophobacter fumaroxidans is its remarkable ability to degrade propionate in syntrophic association with methanogenic organisms. This syntrophic relationship proves essential for the energy metabolism of this bacterium in anaerobic environments where respiratory electron acceptors may be limited. Additionally, Syntrophobacter fumaroxidans demonstrates metabolic versatility by utilizing sulfate and thiosulfate as alternative electron acceptors for propionate degradation .

The complete genomic sequencing of Syntrophobacter fumaroxidans has provided researchers with valuable insights into its metabolic pathways and genetic composition, including the nuoK2 gene that encodes the NADH-quinone oxidoreductase subunit K 2. This genomic information serves as a foundation for understanding the bacterium's unique ecological niche and biochemical capabilities .

Table 2: Taxonomic Classification of Syntrophobacter fumaroxidans

Taxonomic LevelClassification
DomainBacteria
PhylumThermodesulfobacteriota
ClassSyntrophobacteria
OrderSyntrophobacterales
FamilySyntrophobacteraceae
GenusSyntrophobacter
SpeciesS. fumaroxidans
Type StrainMPOB (DSM 10017)
CharacteristicsSyntrophic propionate-degrading, sulfate-reducing bacterium
Genome StatusFully sequenced

Functional Properties of NADH-quinone oxidoreductase

NADH-quinone oxidoreductases (NQOs) represent a class of enzymes that catalyze the transfer of electrons from NAD(P)H to quinones, playing crucial roles in cellular respiratory chains and energy metabolism. These enzymes can be categorized into two distinct types: Type I (NDH-1) and Type II (NDH-2), with the nuoK2 protein from Syntrophobacter fumaroxidans functioning as a subunit of the Type I complex .

Type I NADH-quinone oxidoreductases, also known as Complex I in the respiratory chain, operate as large multi-subunit complexes that couple electron transfer from NADH to quinones with proton or sodium translocation across the membrane. This sophisticated mechanism contributes significantly to the generation of a proton gradient that drives ATP synthesis, the primary energy currency of the cell .

In contrast, Type II NADH-quinone oxidoreductases (NDH-2) exist as single polypeptides that catalyze the two-electron transfer from NAD(P)H to quinones without any energy-transducing capabilities. These enzymes demonstrate resistance to Complex I-specific inhibitors such as piericidin A, capsaicin, and rotenone, and primarily function in the turnover of NAD(P)H .

Table 3: Comparison of NADH-quinone oxidoreductase Types

FeatureType I (NDH-1)Type II (NDH-2)
StructureLarge multi-subunit complexSingle polypeptide
Energy TransductionCoupled with proton/sodium translocationNo energy-transducing site
Molecular MassLarge (>14 subunits)Approximately 50 kDa
Inhibitor SensitivitySensitive to piericidin A, capsaicin, and rotenoneResistant to these inhibitors
Primary FunctionElectron transfer coupled with energy transductionTwo-electron transfer without energy transduction
Binding MotifsVarious, dependent on specific subunitTypically contains two GXGXXG motifs within β-sheet-α-helix-β-sheet structures
Cellular RoleCentral to respiratory chain and energy productionPrimarily involved in NAD(P)H turnover

The specific function of the nuoK2 subunit within the larger NADH-quinone oxidoreductase complex likely involves maintaining structural integrity, facilitating proper assembly, and potentially contributing to the proton-pumping mechanism that couples electron transfer to energy conservation .

Research Implications and Potential Applications

Research on NADH-quinone oxidoreductases has revealed their fundamental importance in cellular energy metabolism and their potential involvement in various biological processes beyond basic respiration. While specific research findings focused exclusively on nuoK2 from Syntrophobacter fumaroxidans may be limited in the current literature, broader studies on NADH-quinone oxidoreductases have demonstrated their critical roles in electron transfer chains and cellular energetics .

In mammalian systems, NAD(P)H:quinone oxidoreductases (particularly NQO1) have been identified as multifunctional proteins with antioxidant activities, anti-inflammatory effects, and interactions with tumor suppressor proteins. Recent studies have also suggested protective roles against cardiovascular damage and metabolic disorders, highlighting the diverse functions these enzymes may perform in different biological contexts .

The study of bacterial NADH-quinone oxidoreductases, including the nuoK2 from Syntrophobacter fumaroxidans, provides valuable insights into bacterial energy metabolism and may identify potential targets for antimicrobial agents. Furthermore, understanding the structure and function of these proteins contributes to our broader knowledge of electron transfer mechanisms in biological systems, with potential applications in biotechnology and synthetic biology .

Future Research Directions

The current understanding of Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2 (nuoK2) presents numerous opportunities for future research endeavors. Several promising research directions could significantly advance our knowledge of this protein and its applications:

Detailed structural analysis through advanced techniques such as X-ray crystallography, nuclear magnetic resonance spectroscopy, or cryo-electron microscopy would provide precise three-dimensional structural information about nuoK2. This structural data would illuminate the protein's functional mechanisms and facilitate structure-based drug design or protein engineering efforts .

Investigation of protein-protein interactions between nuoK2 and other components of the respiratory chain could reveal important regulatory mechanisms and structural requirements for complex assembly. Techniques such as co-immunoprecipitation, yeast two-hybrid systems, or proximity labeling approaches would provide valuable insights into these interactions .

Exploration of the protein's role in the anaerobic metabolism of Syntrophobacter fumaroxidans, particularly in the context of syntrophic relationships with methanogenic organisms, would enhance our understanding of microbial community dynamics and energy flow in anaerobic ecosystems. This knowledge could inform strategies for optimizing bioremediation processes or methane production in anaerobic digesters .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
nuoK2; Sfum_1938; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Target Names
nuoK2
Target Protein Sequence
MIVPFGHVLLLAGALFGLGVFCAVARRNLIMIVLGVEIMLNAASIAFIGAAARWQSMEGQ AFVLFILAVAATEVSIGLAIIVYAFRRTGSFDPAAYNLMKAGDAMQSFERRGPQ
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction with proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. This mechanism conserves the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of NADH-quinone oxidoreductase in S. fumaroxidans energy metabolism?

NADH-quinone oxidoreductase (Complex I) in S. fumaroxidans functions as a key component in the electron transport chain, coupling NADH oxidation to quinone reduction while pumping protons across the membrane. In S. fumaroxidans, this complex is particularly significant for energy conservation during syntrophic metabolism . During propionate degradation via the methylmalonyl-CoA pathway, Complex I likely participates in the energetically demanding oxidation of succinate to fumarate, which requires reverse electron transport due to the unfavorable redox potential difference between succinate (+30 mV) and menaquinone (-80 mV) . The NuoK2 subunit, as a membrane-embedded component, is presumed to participate in the proton translocation mechanism essential for maintaining the proton gradient that drives these endergonic reactions.

How does the membrane topology of nuoK2 contribute to proton translocation?

The nuoK2 subunit, like other K subunits in bacterial Complex I, likely contains multiple transmembrane helices that form part of the membrane domain involved in proton translocation. The structural arrangement of these helices creates channels through which protons can be translocated across the membrane during the catalytic cycle. While specific structural data for S. fumaroxidans nuoK2 is not available in the literature, studies of homologous subunits suggest that conserved charged residues within these transmembrane regions play critical roles in defining proton pathways . The nuoK2 subunit likely contributes to the conformational changes that couple electron transfer in the hydrophilic domain to proton pumping across the membrane, a process essential for energy conservation in this syntrophic bacterium.

What experimental approaches can confirm the localization of nuoK2 within the membrane?

TechniqueApplication to nuoK2AdvantagesLimitations
Membrane fractionationConfirms membrane associationRelatively simple techniqueLimited resolution for specific topology
GFP fusion analysisVisualizes cellular localizationWorks in vivoMay affect protein folding
Protease accessibilityMaps exposed regionsDefines topologyRequires specific antibodies
Epitope taggingIdentifies orientationCan be used with various detection methodsTags may interfere with function
Cryo-EMDetermines structure within complexHigh-resolution structural dataTechnically challenging

For definitive localization studies, researchers should employ a combination of these techniques. Particularly effective would be creating serial truncations of nuoK2 fused with reporter tags, followed by membrane fractionation and protease accessibility assays under anaerobic conditions to preserve native conformation .

What expression systems are optimal for producing recombinant S. fumaroxidans nuoK2?

The expression of recombinant membrane proteins like nuoK2 presents significant challenges due to their hydrophobic nature and complex folding requirements. For S. fumaroxidans nuoK2, researchers should consider specialized expression systems designed for membrane proteins:

  • E. coli C41(DE3) or C43(DE3) strains are engineered specifically for membrane protein expression and can tolerate higher levels of potentially toxic membrane proteins.

  • Cell-free expression systems supplemented with nanodiscs or liposomes provide a membrane environment for proper folding while bypassing cytotoxicity issues.

  • Anaerobic expression conditions should be maintained given S. fumaroxidans' strict anaerobic lifestyle, as oxygen exposure may affect protein folding and stability .

  • Codon optimization for the expression host is essential since S. fumaroxidans, as a deltaproteobacterium, may have a different codon usage bias compared to common expression hosts.

  • Using a low-copy-number plasmid with tunable promoters (like the tetracycline-inducible system) allows for controlled expression levels to prevent aggregation.

Expression should be verified using Western blotting with antibodies against an affinity tag (preferably at the C-terminus to minimize interference with membrane insertion) and activity assays in membrane preparations.

What purification strategies maintain the native conformation of nuoK2?

Purification of membrane proteins like nuoK2 requires specialized approaches to maintain structural integrity and function:

  • Initial solubilization should use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin, which have been successful with other NADH-quinone oxidoreductase subunits.

  • The entire purification process must be conducted under strictly anaerobic conditions, ideally in an anaerobic chamber, to prevent oxidative damage to the protein .

  • Affinity chromatography using a His-tag followed by size exclusion chromatography in the presence of appropriate detergent micelles or nanodiscs is a recommended two-step purification strategy.

  • Addition of lipids from S. fumaroxidans or similar anaerobic bacteria during purification can help maintain the native environment.

  • Stability assessment using differential scanning fluorimetry can identify optimal buffer conditions that preserve protein integrity.

For functional studies, reconstitution into proteoliposomes composed of lipids similar to the native membrane composition of S. fumaroxidans will help maintain physiologically relevant activity.

How can researchers assess the role of nuoK2 in reverse electron transport?

The investigation of nuoK2's role in reverse electron transport requires sophisticated bioenergetic analyses:

  • Development of a genetic system for creating nuoK2 knockout or conditional mutants in S. fumaroxidans to observe phenotypic changes during growth on propionate under syntrophic conditions.

  • Membrane potential measurements using voltage-sensitive dyes in wild-type versus nuoK2-modified strains to quantify the contribution to proton motive force generation.

  • Reconstitution of purified nuoK2 (or the entire Complex I) into proteoliposomes loaded with pH-sensitive fluorophores to directly measure proton pumping activity.

  • Comparative proteomics analysis of S. fumaroxidans grown under different conditions (fumarate fermentation, sulfate reduction, syntrophic growth) to correlate nuoK2 expression levels with metabolic modes .

  • Site-directed mutagenesis of conserved charged residues in nuoK2, followed by functional assays to identify amino acids essential for proton translocation during reverse electron flow.

The combined results from these approaches would provide comprehensive insights into how nuoK2 contributes to the bioenergetics of reverse electron transport in this syntrophic bacterium.

What is the relationship between nuoK2 function and interspecies electron transfer?

In syntrophic cultures, S. fumaroxidans must maintain extremely low concentrations of hydrogen (1 Pa) and formate (10 μM) to make propionate oxidation energetically favorable . The potential relationship between nuoK2 and interspecies electron transfer can be investigated through:

  • Coculture experiments comparing wild-type S. fumaroxidans with nuoK2 mutants grown syntrophically with methanogens like Methanospirillum hungatei or Methanobacterium formicicum to assess growth rates, substrate utilization, and methane production.

  • Measurements of hydrogen and formate production rates in membrane vesicles with functional or inactivated nuoK2 to determine its contribution to electron carrier generation.

  • Transcriptomic analysis correlating nuoK2 expression with genes encoding hydrogenases and formate dehydrogenases under different syntrophic partnership conditions.

  • Construction of a syntrophic coculture system similar to that developed with Geobacter sulfurreducens , but specifically designed to test the impact of nuoK2 modifications on interspecies electron transfer.

These experiments would illuminate how nuoK2, as part of Complex I, influences the production and transfer of electron carriers critical for syntrophic relationships.

How can cryo-EM be optimized for structural determination of S. fumaroxidans Complex I containing nuoK2?

Cryo-electron microscopy (cryo-EM) offers powerful capabilities for resolving membrane protein structures, though specialized approaches are needed for anaerobic proteins like nuoK2:

  • Sample preparation must occur under strictly anaerobic conditions, potentially using anaerobic glove boxes integrated with cryo-EM sample preparation equipment.

  • Purification of the entire Complex I rather than isolated nuoK2 is recommended, as the subunit likely requires the structural context of the complex for stability.

  • Reconstitution into nanodiscs rather than detergent micelles often provides a more native-like lipid environment and improved particle orientation distribution for imaging.

  • Focused refinement techniques during image processing can enhance resolution specifically around the membrane domain containing nuoK2.

  • Contrast enhancement using phase plates may improve visualization of the transmembrane regions where nuoK2 resides.

  • Comparative analysis with structures of Complex I from related Deltaproteobacteria can help identify unique features of S. fumaroxidans Complex I related to its syntrophic lifestyle.

The resulting structural data would provide unprecedented insights into how nuoK2 contributes to the proton pumping mechanism in this metabolically versatile organism.

What computational approaches can predict nuoK2-specific inhibitors for experimental use?

Computational design of nuoK2-specific inhibitors would provide valuable research tools:

  • Homology modeling of nuoK2 based on structurally characterized homologs from other bacteria, with particular attention to the unique features of S. fumaroxidans.

  • Molecular dynamics simulations of the modeled nuoK2 within a lipid bilayer to identify conformational changes during the catalytic cycle.

  • Virtual screening of compound libraries against predicted binding pockets, focusing on regions unique to S. fumaroxidans nuoK2 compared to homologs from non-syntrophic bacteria.

  • Quantum mechanical calculations to optimize interactions between lead compounds and key residues in identified binding sites.

  • Molecular docking studies comparing binding affinities across different oxidoreductase subunits to ensure specificity for nuoK2.

The predicted inhibitors should then be synthesized and tested experimentally for their effects on isolated Complex I activity and whole-cell metabolism of S. fumaroxidans under various growth conditions.

How does nuoK2 differ from nuoK1 in S. fumaroxidans, and what does this suggest about their specialized functions?

The designation "nuoK2" suggests the existence of multiple isoforms of this subunit in S. fumaroxidans. Comparative analysis between nuoK1 and nuoK2 would reveal:

  • Sequence divergence patterns indicating potential differences in substrate specificity, proton pumping efficiency, or regulatory mechanisms.

  • Expression pattern differences across growth conditions, potentially revealing specialized roles for each isoform in forward versus reverse electron transport.

  • Structural variations that might adapt each isoform to different electron transfer directionalities or interactions with other respiratory components.

  • Evolutionary history suggesting whether nuoK2 arose from gene duplication followed by specialization, or horizontal gene transfer from other organisms.

  • Conservation patterns across different syntrophic bacteria that might correlate with metabolic capabilities.

Given that S. fumaroxidans employs multiple energy conservation mechanisms including the menaquinone loop and confurcating enzymes , the presence of specialized Complex I isoforms would be consistent with its metabolic versatility.

What can phylogenetic analysis of nuoK2 reveal about the evolution of syntrophic metabolism?

Phylogenetic analysis of nuoK2 across diverse bacteria can provide insights into the evolutionary trajectory of syntrophic metabolism:

Taxonomic GroupRepresentative OrganismsnuoK2 FeaturesMetabolic Capability
SyntrophobacteraceaeS. fumaroxidans, S. wolinii[Specific features]Syntrophic propionate oxidation
Other DeltaproteobacteriaDesulfobacterium autotrophicum[Specific features]Sulfate reduction with syntrophic potential
Non-syntrophic Sulfate ReducersDesulfovibrio species[Specific features]Strict sulfate reduction
Syntrophic FirmicutesSyntrophomonas wolfei[Specific features]Syntrophic butyrate oxidation
Methanogenic partnersMethanospirillum hungatei[If applicable]Hydrogen/formate utilization

How might synthetic biology approaches utilize engineered nuoK2 to enhance syntrophic consortia for biotechnological applications?

Synthetic biology offers exciting possibilities for engineering nuoK2 to enhance syntrophic relationships:

  • Targeted modifications to increase proton pumping efficiency could potentially accelerate reverse electron transport, making syntrophic propionate degradation more energetically favorable.

  • Construction of chimeric nuoK subunits combining features from different organisms might create Complex I variants with improved performance under specific conditions.

  • Inducible expression systems controlling nuoK2 levels could allow dynamic regulation of electron flow in engineered consortia responding to changing substrate availability.

  • Integration of nuoK2 variants into non-syntrophic organisms could potentially confer new metabolic capabilities, enabling novel syntrophic partnerships.

  • Development of biosensors based on nuoK2 activity could provide real-time monitoring of syntrophic interactions in bioreactors.

These approaches could lead to enhanced methane production in anaerobic digesters, improved bioremediation of propionate-rich waste streams, and development of synthetic syntrophic consortia for production of biofuels or other value-added products.

What novel spectroscopic methods might reveal the real-time dynamics of nuoK2 during electron transport?

Advanced spectroscopic techniques could provide unprecedented insights into nuoK2 function:

  • Time-resolved FTIR difference spectroscopy coupled with site-directed labeling to track protonation/deprotonation events in specific amino acid residues during the catalytic cycle.

  • Single-molecule FRET experiments with fluorescently labeled nuoK2 to observe conformational changes associated with proton translocation in real-time.

  • Electron paramagnetic resonance (EPR) spectroscopy with spin-labeled nuoK2 variants to monitor distances between specific residues during different functional states.

  • Solid-state NMR of reconstituted nuoK2 in nanodiscs to determine dynamic changes in structure during interaction with other Complex I components.

  • Second harmonic generation (SHG) microscopy to directly observe voltage changes across membranes containing functional nuoK2 during electron transport.

These cutting-edge approaches would bridge the gap between static structural studies and functional analyses, providing a dynamic view of how nuoK2 participates in the complex process of energy conservation in syntrophic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.