Recombinant Syntrophobacter fumaroxidans UPF0059 membrane protein Sfum_0431 (Sfum_0431)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

AttributeDetails
Gene NamemntP
SynonymsSfum_0431; Putative manganese efflux pump MntP
UniProt IDA0LFC9

Sfum_0431 is annotated as a manganese efflux pump, a critical component for maintaining intracellular metal ion homeostasis. While its precise mechanism remains uncharacterized in S. fumaroxidans, homologs in other bacteria suggest it may utilize proton/metal ion antiport to expel excess manganese .

Expression and Refolding

The protein is expressed in E. coli with an N-terminal His-tag for affinity chromatography purification. Post-expression, it is lyophilized and stored in trehalose/glycerol-based buffers to stabilize tertiary structure .

Applications and Research Relevance

  1. Metal Ion Transport Studies: Sfum_0431 serves as a model for investigating manganese efflux mechanisms in sulfate-reducing bacteria.

  2. Syntrophic Interactions: While not directly studied, S. fumaroxidans relies on syntrophic partnerships for propionate degradation, suggesting potential roles in electron transfer or metabolite transport .

  3. Biotechnological Tools: The His-tagged version enables structural studies via X-ray crystallography or cryo-EM .

Research Gaps and Future Directions

  • Functional Validation: Experimental confirmation of manganese efflux activity is pending.

  • Structural Insights: Cryo-EM or NMR studies could elucidate its transmembrane topology and substrate-binding sites.

  • Syntrophic Relevance: Linking Sfum_0431 to S. fumaroxidans’s metabolic partnerships (e.g., with methanogens) remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate any special format requirements. Please specify your desired format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life of our products depends on factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms maintain stability for 6 months at -20°C/-80°C, while lyophilized forms remain stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
mntP; Sfum_0431; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Target Names
mntP
Target Protein Sequence
MSVVETVLVALALGCDAFAVGMGVGTRFCNPRQIFRLSFHFGLFQMMMPIAGWFVGSRAA DLVSTWGPWISFALLLFIGGKMAYESFRSLEAEDGECPDPTKGSSLVMLSVATSMDALGV GFSFGILGQQLFLSAVWIGITAGIMTWGAMRLGNRLSRQFGRRMETVGGLILVAIAVKLL LF
Uniprot No.

Target Background

Function
Sfum_0431, a membrane protein from *Syntrophobacter fumaroxidans*, likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Sfum_0431 protein typically produced for research purposes?

The recombinant full-length Sfum_0431 protein is typically produced through heterologous expression in Escherichia coli expression systems. The process involves:

  • Cloning the Sfum_0431 gene (corresponding to amino acids 1-182) into an appropriate expression vector

  • Adding an N-terminal His-tag to facilitate purification

  • Transforming the construct into E. coli expression hosts

  • Inducing protein expression under controlled conditions

  • Lysing the cells and purifying the recombinant protein using affinity chromatography

This approach yields purified recombinant protein suitable for various downstream research applications, including structural studies, functional assays, and interaction analyses . The expression in E. coli represents a methodological choice balancing protein yield, proper folding, and research utility.

What is the genome context of Sfum_0431 in Syntrophobacter fumaroxidans?

Sfum_0431 is one of the 4098 protein-coding genes identified in the S. fumaroxidans genome. Proteomic analysis studies have demonstrated that the S. fumaroxidans proteome exhibits differential expression patterns depending on growth conditions, particularly varying with electron acceptors or syntrophic partners . The Sfum_0431 gene encodes a membrane-associated protein that may contribute to the organism's bioenergetic capacities, possibly in conjunction with other membrane-associated systems like the fumarate reductase and Rnf complex that have been identified through genome analyses . Understanding this genomic context is crucial for formulating hypotheses about the protein's potential functions and interactions within the cellular machinery of S. fumaroxidans.

How does Sfum_0431 potentially contribute to energy conservation mechanisms in Syntrophobacter fumaroxidans?

The contribution of Sfum_0431 to energy conservation in S. fumaroxidans must be contextualized within the organism's broader bioenergetic framework. S. fumaroxidans employs complex energy conservation mechanisms including reverse electron transport (RET) involving membrane-associated components like fumarate reductase and the Rnf complex . Additionally, novel energy conversion systems such as flavin-based electron bifurcation and its reversal (electron confurcation) have been discovered in anaerobic microorganisms like S. fumaroxidans .

As a membrane protein, Sfum_0431 might participate in these energy conservation pathways through:

  • Potential interactions with established membrane complexes

  • Involvement in proton or electron transfer across the membrane

  • Structural contributions to organized membrane protein complexes

  • Roles in substrate transport relevant to energy metabolism

Research examining protein abundance patterns across different growth conditions could illuminate Sfum_0431's specific contributions to these energy conservation mechanisms. For instance, comparative proteomics approaches similar to those that identified differential expression of formate dehydrogenases and hydrogenases could reveal condition-dependent regulation of Sfum_0431 .

What expression patterns of Sfum_0431 have been observed under different growth conditions?

While specific expression patterns of Sfum_0431 across different growth conditions are not directly reported in the available literature, insights can be drawn from broader proteomic studies of S. fumaroxidans. Comprehensive proteomics analysis has demonstrated that protein abundance patterns in S. fumaroxidans vary significantly depending on the electron acceptor or syntrophic partner used .

For example, cytoplasmic Fdh1 (Sfum_2703-06) and periplasmic Fdh2 (Sfum_1273-75) were found to be the most abundant formate dehydrogenases across multiple conditions, with significantly higher levels during syntrophic growth. Similarly, the membrane-bound Fhl-f (Sfum_1795–1806) showed higher abundance in syntrophically grown cells compared to axenic growth .

Research examining Sfum_0431 expression would likely employ similar methodological approaches:

  • Culturing S. fumaroxidans under varied conditions (axenic vs. syntrophic)

  • Employing proteomic analysis to quantify Sfum_0431 abundance

  • Correlating expression patterns with physiological parameters

  • Integrating these findings with data on other functional proteins

This type of analysis would provide insights into the physiological conditions under which Sfum_0431 plays more prominent roles.

What structural features characterize Sfum_0431 and how do they relate to its putative functions?

As a member of the UPF0059 membrane protein family, Sfum_0431 likely contains multiple transmembrane domains that anchor it within the cytoplasmic membrane. While detailed structural data specific to Sfum_0431 is limited in the available literature, several analytical approaches can be employed to predict and characterize its structural features:

  • Bioinformatic analysis using transmembrane prediction algorithms

  • Sequence homology modeling based on related proteins with solved structures

  • Secondary structure prediction to identify alpha-helical and beta-sheet regions

  • Identification of conserved motifs that might indicate functional domains

These structural features would inform hypotheses regarding the protein's function, potentially including roles in:

  • Substrate transport across the membrane

  • Protein-protein interactions within membrane complexes

  • Signal transduction between periplasm and cytoplasm

  • Structural support for larger membrane-associated complexes

Experimental validation of these predicted features would typically involve techniques such as site-directed mutagenesis, cysteine scanning, cross-linking studies, or structural biology approaches if sufficient protein can be purified.

What experimental design considerations are crucial when studying Sfum_0431 expression under different growth conditions?

When designing experiments to study Sfum_0431 expression under different growth conditions, researchers should consider several critical factors:

  • Selection of appropriate growth conditions:

    • Pure culture with different electron acceptors (e.g., fumarate, sulfate)

    • Syntrophic growth with methanogenic partners

    • Varying substrate concentrations and types

    • Different growth phases (exponential vs. stationary)

  • Controls and variables management:

    • Maintaining consistent parameters across experimental groups except for the variable of interest

    • Including appropriate biological and technical replicates (minimum triplicate)

    • Randomizing sample processing to minimize systematic errors

    • Implementing proper statistical design to enable robust analysis

  • Quantification methods:

    • Selecting appropriate proteomic techniques (e.g., LC-MS/MS)

    • Developing targeted assays for Sfum_0431 quantification

    • Employing absolute vs. relative quantification approaches

    • Validating findings with complementary techniques (e.g., immunoblotting)

  • Data analysis framework:

    • Principal component analysis to identify patterns in protein abundance

    • Statistical methods to identify significant differences between conditions

    • Correlation analysis with physiological parameters

    • Network analysis to identify co-expressed proteins

This experimental design framework ensures rigorous testing of hypotheses regarding Sfum_0431 expression patterns and their relationship to cellular function.

What are the optimal purification methods for obtaining functional recombinant Sfum_0431 protein?

Purifying functional membrane proteins presents unique challenges due to their hydrophobic nature and requirement for appropriate environments to maintain native conformations. For Sfum_0431, the following purification methodology would be considered optimal:

Expression optimization:

  • Testing multiple E. coli expression strains (e.g., BL21(DE3), C41(DE3), C43(DE3))

  • Evaluating different induction parameters (temperature, IPTG concentration, duration)

  • Considering fusion partners beyond His-tag that might enhance solubility

  • Exploring co-expression with chaperones to improve folding

Membrane extraction:

  • Cell disruption via sonication or high-pressure homogenization

  • Differential centrifugation to isolate membrane fractions

  • Careful selection of detergents for membrane solubilization

  • Optimization of detergent:protein ratios

Purification steps:

  • Initial capture via immobilized metal affinity chromatography (IMAC) utilizing the N-terminal His-tag

  • Secondary purification via size exclusion or ion exchange chromatography

  • Quality assessment via SDS-PAGE, Western blotting, and mass spectrometry

  • Functional validation through appropriate activity assays

Storage considerations:

  • Determination of optimal detergent or reconstitution system

  • Evaluation of buffer components for stability

  • Assessment of freeze-thaw stability

  • Long-term storage optimization (4°C, -20°C, -80°C)

This methodological approach balances the need for high purity with the requirement to maintain the protein in a functional state, which is essential for downstream structural and functional studies.

How can researchers effectively design experiments to investigate protein-protein interactions involving Sfum_0431?

Investigating protein-protein interactions involving membrane proteins like Sfum_0431 requires specialized approaches. A comprehensive experimental design would include:

In vivo approaches:

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Co-immunoprecipitation with antibodies against Sfum_0431 or potential partners

  • Crosslinking studies in native membranes followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

In vitro approaches:

  • Pull-down assays using purified His-tagged Sfum_0431

  • Surface plasmon resonance (SPR) with immobilized Sfum_0431

  • Isothermal titration calorimetry (ITC) for quantitative binding parameters

  • Reconstitution studies in proteoliposomes or nanodiscs

Computational approaches:

  • Protein-protein interaction prediction based on structural models

  • Co-expression analysis across multiple conditions

  • Evolutionary coupling analysis to identify co-evolving residues

  • Integration of interaction data with metabolic models

Validation strategies:

  • Mutation of predicted interaction interfaces

  • Competition assays with peptides derived from interaction domains

  • Functional assays to assess biological relevance of interactions

  • Structural characterization of protein complexes

This multi-faceted approach acknowledges the challenges of studying membrane protein interactions while providing multiple lines of evidence to support any identified interactions involving Sfum_0431.

How should researchers interpret changes in Sfum_0431 expression relative to other membrane proteins in S. fumaroxidans?

Interpreting changes in Sfum_0431 expression requires contextualizing these changes within broader protein expression patterns. Researchers should:

  • Perform comparative analysis:

    • Compare Sfum_0431 expression changes with proteins of known function

    • Identify proteins with similar expression patterns across conditions

    • Analyze co-expression networks to identify functionally related proteins

    • Compare expression changes with other membrane proteins, particularly those involved in energy conservation

  • Apply statistical frameworks:

    • Use appropriate statistical tests to determine significant differences

    • Apply multiple testing corrections to minimize false positives

    • Employ principal component analysis to identify major variables driving expression changes

    • Calculate correlation coefficients between expression patterns of different proteins

  • Consider physiological context:

    • Relate expression changes to growth rates and metabolic efficiency

    • Analyze expression in context of electron acceptor availability

    • Examine relationships between expression and metabolite concentrations

    • Compare syntrophic vs. axenic growth conditions, as these have shown distinct protein profiles

  • Develop interpretive models:

    • Propose functional models that explain observed expression patterns

    • Create testable hypotheses based on expression correlations

    • Integrate expression data with available functional information

    • Consider evolutionary conservation of expression patterns across related species

This interpretive framework allows researchers to move beyond descriptive observations toward mechanistic understanding of Sfum_0431's role in cellular physiology.

What approaches can resolve apparent contradictions in experimental data regarding Sfum_0431 function?

Contradictions in experimental data are common in biological research and require systematic approaches to resolution. For Sfum_0431 research, researchers should:

  • Examine methodological differences:

    • Compare experimental conditions between contradictory studies

    • Evaluate differences in protein expression systems and purification methods

    • Consider variations in assay conditions and detection methods

    • Assess potential differences in protein constructs (full-length vs. truncated variants)

  • Conduct reconciliation experiments:

    • Design experiments specifically targeting the contradictory results

    • Systematically vary experimental parameters to identify critical variables

    • Perform side-by-side comparisons using standardized protocols

    • Include appropriate controls to validate assay performance

  • Consider biological complexity:

    • Investigate potential post-translational modifications affecting function

    • Examine protein-protein interactions that might modulate activity

    • Evaluate the impact of membrane composition on protein behavior

    • Assess the influence of cellular energetic state on protein function

  • Apply integrative analysis:

    • Develop mathematical models to reconcile apparently contradictory data

    • Use Bayesian approaches to weigh evidence from different experiments

    • Conduct meta-analysis of available data to identify patterns

    • Employ systems biology approaches to contextualize contradictory findings

This structured approach transforms apparent contradictions from obstacles into opportunities for deeper understanding of Sfum_0431's complex biological functions.

How can proteomics data be effectively used to generate hypotheses about Sfum_0431 function?

Proteomics data offers a rich resource for hypothesis generation regarding Sfum_0431 function. Researchers should implement the following analytical framework:

  • Expression pattern analysis:

    • Identify conditions that significantly alter Sfum_0431 abundance

    • Compare Sfum_0431 expression patterns with proteins of known function

    • Analyze temporal changes in expression during growth or stress response

    • Examine subcellular localization through fractionation-based proteomics

  • Co-expression network construction:

    • Build networks of co-expressed proteins across multiple conditions

    • Identify functional modules containing Sfum_0431

    • Apply gene set enrichment analysis to characterize these modules

    • Use weighted correlation network analysis to identify hub proteins

  • Post-translational modification mapping:

    • Identify potential phosphorylation, glycosylation, or other modifications

    • Correlate modifications with specific growth conditions

    • Examine conservation of modification sites across related species

    • Predict functional consequences of identified modifications

  • Comparative analysis across species:

    • Identify homologs of Sfum_0431 in related organisms

    • Compare expression patterns of homologs under similar conditions

    • Analyze conservation of genomic context and potential operons

    • Examine evolutionary rate of sequence change as indicator of functional constraints

The insights derived from this proteomics-based analytical framework can guide the design of targeted experiments to test specific hypotheses about Sfum_0431 function, potentially revealing its role in energy conservation mechanisms similar to those identified for other membrane proteins in S. fumaroxidans .

What novel experimental techniques could advance our understanding of Sfum_0431 structure and function?

Advancing our understanding of Sfum_0431 will require application of cutting-edge techniques including:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for membrane protein structures without crystallization

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic structural elements

    • Solid-state NMR in native-like membrane environments

    • Single-particle analysis of protein complexes containing Sfum_0431

  • High-resolution functional analysis:

    • Single-molecule FRET to monitor conformational changes

    • Patch-clamp electrophysiology if ion transport function is suspected

    • Nanopore-based analysis of potential channel or transport functions

    • In vitro reconstitution in synthetic membranes with defined composition

  • Genetic and genomic approaches:

    • CRISPR-Cas9 engineering of S. fumaroxidans for precise genetic manipulation

    • Conditional expression systems to control Sfum_0431 levels

    • Transposon mutagenesis to identify genetic interactions

    • RNA-Seq analysis to identify transcriptional responses to Sfum_0431 perturbation

  • Systems biology integration:

    • Multi-omics analysis combining proteomics, metabolomics, and transcriptomics

    • Flux balance analysis incorporating Sfum_0431 function into metabolic models

    • Machine learning approaches to predict function from integrated datasets

    • Network modeling of protein-protein interactions involving Sfum_0431

These advanced techniques would complement more traditional approaches, potentially yielding transformative insights into Sfum_0431's role in the complex energy conservation mechanisms employed by S. fumaroxidans .

How might research on Sfum_0431 contribute to broader understanding of membrane protein function in anaerobic bacteria?

Research on Sfum_0431 has potential to advance our understanding of membrane protein biology in several key areas:

  • Energy conservation mechanisms:

    • Elucidation of novel components in reverse electron transport systems

    • Insights into membrane protein complexes involved in electron bifurcation/confurcation

    • Contributions to understanding proton-motive force generation in anaerobes

    • Potential discovery of new energy coupling mechanisms

  • Syntrophic interactions:

    • Understanding membrane protein adaptations for interspecies electron transfer

    • Insights into molecular mechanisms underlying obligate syntrophic lifestyles

    • Potential discovery of specialized membrane structures for cell-cell interactions

    • Clarification of membrane protein expression changes during syntrophic growth

  • Evolutionary adaptations:

    • Identification of conserved membrane protein families in anaerobic lifestyles

    • Understanding of specialized adaptations for energy-limited environments

    • Insights into evolution of protein complexes under selective pressure

    • Comparative analysis across diverse anaerobic microorganisms

  • Methodological advances:

    • Development of improved approaches for studying challenging membrane proteins

    • Refinement of heterologous expression systems for anaerobe proteins

    • Advances in functional characterization of proteins with unknown function

    • Novel analytical frameworks for interpreting complex datasets

These broader contributions highlight how focused research on a single protein like Sfum_0431 can catalyze advances across multiple dimensions of anaerobic microbiology and membrane protein biology.

What experimental design would best assess the potential role of Sfum_0431 in syntrophic interactions?

Investigating Sfum_0431's role in syntrophic interactions requires a comprehensive experimental design that incorporates:

  • Comparative expression analysis:

    • Quantitative proteomics comparing Sfum_0431 levels in:

      • Pure culture with different electron acceptors

      • Co-culture with different methanogenic partners

      • Varying substrate concentrations and types

      • Different growth phases

    This approach would build upon established proteomics methods that have successfully identified differential protein expression patterns in S. fumaroxidans under various growth conditions .

  • Genetic manipulation studies:

    • Creation of Sfum_0431 knockout or knockdown strains

    • Complementation with wild-type or mutant variants

    • Overexpression studies to assess phenotypic effects

    • Introduction of tagged versions for localization studies

  • Physiological characterization:

    • Growth kinetics measurements comparing wild-type and modified strains

    • Substrate utilization and product formation rates

    • Electron flow measurements using redox indicators

    • Membrane potential assessments using fluorescent probes

  • Co-culture experiments:

    • Interspecies electron transfer measurements

    • Competition experiments with wild-type and modified strains

    • Microscopy to assess physical associations between syntrophic partners

    • Transcriptional response of partners to Sfum_0431 perturbation

  • Data integration framework:

    Experimental ApproachMeasured ParametersExpected Outcomes
    ProteomicsProtein abundance across conditionsCorrelation of Sfum_0431 with syntrophic growth
    Genetic studiesGrowth rates, metabolic profilesPhenotypic effects of Sfum_0431 modification
    BioenergeticsMembrane potential, ATP levelsEnergy conservation role assessment
    Partner interactionsGrowth rates, spatial organizationImpact on syntrophic relationship
    TranscriptomicsGene expression changesRegulatory networks involving Sfum_0431

This experimental design would generate a comprehensive dataset allowing researchers to determine whether Sfum_0431 plays a critical role in the syntrophic lifestyle of S. fumaroxidans, similar to other membrane-associated proteins that have been implicated in energy conservation mechanisms during syntrophic growth .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.