Recombinant Syntrophomonas wolfei subsp. wolfei Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Syntrophomonas wolfei subsp. wolfei Large-Conductance Mechanosensitive Channel (MscL)

The large-conductance mechanosensitive channel (MscL) from Syntrophomonas wolfei subsp. wolfei is a protein that responds to mechanical stimuli, specifically changes in membrane tension . MscL is the first mechanosensitive ion channel identified in bacteria and opens a large pore when the turgor pressure of the cytoplasm increases . These channels are found in various organisms, including bacteria, and play a crucial role in protecting cells from osmotic shock by opening a pore in the membrane to release solutes when the membrane is stretched .

MscL in Syntrophomonas wolfei

Syntrophomonas wolfei is a bacterium known for its syntrophic metabolism, where it degrades fatty acids in cooperation with other microorganisms . Studies involving S. wolfei have utilized proteomic and transcriptomic approaches to understand the roles of different proteins, including those involved in reverse electron transfer .

Role in Syntrophic Metabolism

In S. wolfei, MscL's function may relate to maintaining cellular integrity under the osmotic stress that can arise during syntrophic metabolism. MscL may function to relieve excess turgor pressure caused by the accumulation of metabolites .

Research Techniques and Findings

  • Proteomics and Transcriptomics Proteomic and transcriptomic analyses have identified proteins and genes that are highly expressed during syntrophic growth of S. wolfei . These techniques help elucidate the function and importance of proteins such as MscL in the metabolic processes of S. wolfei .

  • Gene Expression Studies Quantitative real-time PCR (qRT-PCR) is used to measure the transcript levels of genes encoding polypeptides like Hyd2 hydrogenase, EtfAB2, and iron-sulfur oxidoreductase . These studies have shown that transcripts for hyd2 genes are more abundant in S. wolfei cells grown syntrophically on butyrate compared to axenic cultures .

  • Mutational Analysis Mutants of MscL, such as V23A and I92GI96G, exhibit different effects on cells, with the expression level being the primary cause of observed effects for GOF mutants . Stable cell lines of I92GI96G can be acquired through antibiotic screening, but normal stable cell lines of V23A could not be acquired in the same setting .

  • Electrophysiology Measurements Electrophysiological methods are employed to investigate the threshold required for channel conductance, revealing that mutations can reduce this threshold, consistent with a subconducting state .

Application of MscL Channel in Animal Models

Lentivirus systems are considered for constructing stable expression to realize the application of the MscL channel in animal models . Cytoplasmic vacuolization can be caused by overexpression of V23A and I29GI96G .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; Swol_1671; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Target Names
mscL
Target Protein Sequence
MWKEFREFAMRGNVIDLAIGIIIGAAFGKIVTSFVNDILMPPIGLLLGKVDFTNLYINLS GKNYSSLADATAAGAPVIKYGVFLNSIIDFIIVAVAIFLVVKQINRLKKQEVAAAPTTKE CRYCKSEISIAATRCPFCTSELLDTGRPLK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Syntrophomonas wolfei and why is its mscL protein significant?

Syntrophomonas wolfei is an anaerobic, syntrophic bacterium that beta-oxidizes saturated fatty acids to acetate or acetate and propionate using protons as electron acceptors. It is a gram-negative, slightly helical rod with flagella laterally inserted along the concave side of the cell . The mscL protein is significant because it functions as a mechanosensitive channel that responds to membrane tension, serving as a pressure-relief valve that protects the cell from lysing during acute osmotic downshock . This channel opens in response to membrane stretch, creating a nonselective pore approximately 30Å wide with a large unitary conductance of ~3 nS .

How does S. wolfei mscL compare functionally with other bacterial mechanosensitive channels?

S. wolfei mscL shares functional conservation with mechanosensitive channels from other bacteria. Comparison of primary sequences reveals two highly conserved regions corresponding to domains important for channel function, along with a C-terminal region that is not conserved across all species . While the mechanosensitive channel function is conserved, channels from different bacteria exhibit variations in kinetics and degree of mechanosensitivity . This functional conservation across diverse bacterial species indicates the evolutionary importance of this pressure-relief mechanism, despite species-specific adaptations in channel properties .

What are the optimal conditions for recombinant expression of S. wolfei mscL?

For recombinant expression of S. wolfei mscL, the protein should be stored in a Tris-based buffer with 50% glycerol that has been specifically optimized for this protein . The recommended storage temperature is -20°C, with extended storage possible at -20°C or -80°C . For active work, aliquots can be maintained at 4°C for up to one week, though repeated freezing and thawing should be avoided as it may compromise protein integrity .

When expressing recombinant membrane proteins from anaerobic organisms like S. wolfei, researchers should consider co-expressing any necessary accessory proteins. For example, when expressing other S. wolfei proteins such as [FeFe]-hydrogenase, co-expression of maturation genes was essential to obtain an active enzyme . The expression tag type should be determined during the production process based on specific experimental requirements .

How can researchers effectively assay the mechanosensitive activity of recombinant S. wolfei mscL?

The gold standard for functional characterization of mechanosensitive channels is patch-clamp electrophysiology. This approach has been successfully used for studying mechanosensitive channels from various bacteria, including putative homologs expressed in E. coli . The method involves:

  • Expressing the recombinant channel in a suitable host or reconstituting purified protein into liposomes

  • Forming a high-resistance seal between a glass micropipette and the membrane containing the channel

  • Applying negative pressure (suction) to induce membrane stretch

  • Recording channel currents and analyzing conductance patterns

This electrophysiological approach allows direct measurement of channel opening in response to membrane tension, providing data on channel conductance, gating threshold, and kinetics .

What post-translational modifications occur in S. wolfei proteins and how might they affect mscL function?

S. wolfei exhibits an extensive acylome profile with six types of acyl-lysine modifications identified across different growth conditions: acetyl-, butyryl-, 3-hydroxybutyryl-, crotonyl-, valeryl-, and hexanyl-lysine . Two of these acylation types had not been previously reported in any biological system . These acylations correspond directly to reactive acyl-Coenzyme A species (RACS) in fatty acid degradation pathways .

A total of 369 modification sites were identified on 237 proteins, with the acylation patterns changing significantly depending on carbon substrate . These modifications were remarkably abundant, as they could be detected without antibody enrichment—a stark contrast to other biological systems where such enrichment is typically necessary .

While the search results don't specifically identify mscL among the acylated proteins, the presence of multiple lysine residues in the S. wolfei mscL sequence suggests potential for such modifications, which could regulate channel function in response to metabolic status.

How does the syntrophic lifestyle of S. wolfei influence protein expression and modification?

S. wolfei can only degrade saturated fatty acids when grown in syntrophic association with hydrogen-utilizing bacteria such as Desulfovibrio species or methanogens . When grown with Methanospirillum hungatei, S. wolfei exhibits generation times of approximately 84 hours, which can be slightly decreased by the addition of Casamino Acids .

Interestingly, proteomic evidence indicates that shifting from axenic (single species) to syntrophic growth conditions does not significantly change protein abundance in S. wolfei . Despite this consistency in protein levels, enzymatic catalysis rates do change with growth conditions, suggesting that post-translational regulation, possibly including the extensive acylations observed in the acylome, may play a significant role in metabolic adaptation .

The addition of hydrogen to the medium stops growth and butyrate degradation by S. wolfei, indicating a regulatory feedback mechanism that may affect multiple cellular processes, potentially including mechanosensitive channel function .

What conformational changes occur during the gating of mechanosensitive channels similar to S. wolfei mscL?

Studies of archaeal MscL homologs have revealed significant conformational rearrangements during channel gating. By comparing structures in closed and expanded intermediate states, researchers observed coordinated movements of different channel domains . The two transmembrane helices (TM1 and TM2) undergo large changes in their tilt angles, consistent with a helix-pivoting model of channel gating . Additionally, the periplasmic loop region transforms from a folded ω-shaped structure during this conformational change .

These structural transitions create a wide pore that allows rapid efflux of solutes during osmotic stress. The detailed understanding of these conformational changes provides insight into the mechanical coupling mechanism that coordinates multiple structural elements of this sophisticated nanoscale valve .

What techniques are most effective for studying the structural dynamics of S. wolfei mscL?

Based on successful approaches with other mechanosensitive channels, the following techniques would be most effective for studying S. wolfei mscL structural dynamics:

TechniqueApplicationAdvantagesLimitations
X-ray CrystallographyDetermination of atomic-resolution structures in different conformational statesHigh resolution; can capture specific states with appropriate crystallization conditionsChallenging for membrane proteins; may not capture dynamic intermediates
Cryo-Electron MicroscopyVisualization of channel structure in near-native environmentCan capture different conformational states; works well for membrane proteinsLower resolution than X-ray crystallography for smaller proteins
Site-Directed Spin Labeling with EPRMeasurement of distances between specific residues during gatingCan track conformational changes in lipid environment; good for dynamicsRequires introduction of spin labels; limited number of measurement points
Molecular Dynamics SimulationsModeling of transition pathways between conformational statesCan provide atomic-level detail of entire gating process; tests mechanistic hypothesesComputationally intensive; accuracy depends on force field parameters

The comparison of structures in different conformational states has proven particularly valuable, as demonstrated by the insights gained from studying an archaeal MscL homolog trapped in closed and expanded intermediate states .

How can researchers investigate potential interactions between S. wolfei mscL and fatty acid metabolism pathways?

S. wolfei utilizes β-oxidation to degrade short-chain fatty acids, and its genome encodes multiple paralogs of enzymes involved in this pathway, including nine acyl-CoA dehydrogenase genes, five enoyl-CoA hydratase genes, six 3-hydroxyacyl-CoA dehydrogenase genes, and five acetyl-CoA acetyltransferase genes . Given the extensive acylation profile that directly connects metabolic intermediates to protein modifications, investigating potential regulatory interactions between mscL and fatty acid metabolism pathways could reveal novel regulatory mechanisms.

A systematic approach would include:

  • Proximity labeling with mscL fused to biotin ligase to identify nearby proteins in the native membrane environment

  • Co-immunoprecipitation to identify stable protein-protein interactions

  • Mass spectrometry analysis to map acylation sites on mscL and correlate with metabolic conditions

  • Site-directed mutagenesis of identified acylation sites to assess functional consequences

  • Lipidomic analysis to determine if local membrane composition around mscL changes with metabolic state

What are the challenges in maintaining native structure and function of S. wolfei mscL during purification?

Purification of functional S. wolfei mscL presents several challenges due to its nature as a membrane protein from an anaerobic organism. Specific challenges include:

  • Extraction from the membrane while preserving native structure requires careful selection of detergents, as highlighted by the importance of "controlling detergent composition" in solving structures of an archaeal MscL homolog

  • Maintaining anaerobic conditions throughout purification may be necessary given S. wolfei's anaerobic nature and the presence of potentially oxidation-sensitive cysteine residues in the C-terminal region of mscL

  • Preserving the native oligomeric state, as mechanosensitive channels typically function as homopentamers or homoheptamers

  • Reconstitution into a membrane environment that supports mechanosensitivity for functional studies

  • Maintaining or controlling post-translational modifications, given the extensive acylation profile observed in S. wolfei proteins

What are the most promising future research directions for S. wolfei mscL studies?

The study of S. wolfei mscL offers several promising research directions that could contribute to our understanding of bacterial osmoregulation, membrane protein dynamics, and metabolic regulation in syntrophic organisms:

  • Structural characterization of S. wolfei mscL in different conformational states to compare with known structures from other organisms and identify species-specific adaptations

  • Investigation of how the extensive acylation profile of S. wolfei affects mscL function, potentially revealing novel regulatory mechanisms connecting metabolism to osmoregulation

  • Examination of how syntrophic growth conditions influence mscL activity, as S. wolfei's lifestyle requires close metabolic cooperation with partner organisms

  • Comparative analysis of mechanosensitive channels across different syntrophic bacteria to identify common adaptations to this ecological niche

  • Development of the S. wolfei mscL system as a model for studying how post-translational modifications regulate membrane protein function in response to metabolic states

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.