Recombinant Syntrophomonas wolfei subsp. wolfei Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; Swol_1287; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Target Names
lspA
Target Protein Sequence
MRFWGSFLLVVILDRISKAWVLASFLPRESRSLIEGGLYLTYVQNRGAAFGLMPGKSWLF FISALLVIMALVIYNWRSKASPLEALSTGLIAGGALGNLIDRYFYGFVIDFIDLGWWPVF NLADSAIVCGGILLLILVLLDGKREERNA
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the lspA gene in Syntrophomonas wolfei and what is its biological significance?

LspA encodes Type II Signal Peptidase (SPase II), an essential enzyme in gram-negative bacteria that processes prolipoproteins by cleaving their signal peptides. In S. wolfei subsp. wolfei, lspA (locus tag: Swol_1287) plays a crucial role in lipoprotein maturation within the cell membrane . The biological significance of lspA stems from its involvement in proper lipoprotein processing, which is critical for bacterial membrane integrity and function .

Research shows that lspA forms part of a complex protein secretion system that includes other key components such as lgt (prolipoprotein diacylglyceryl transferase) and lepB (encoding Type I Signal Peptidase). These three genes work in concert to process and transport proteins across bacterial membranes . In silico predictions from the R. typhi genome, which shares functional similarities with S. wolfei, indicate that out of 89 secretory proteins, only 14 are lipoproteins, suggesting SPase II processes a specific subset of membrane proteins .

What experimental methods are used to verify the functional activity of recombinant S. wolfei lspA?

Two primary experimental approaches are used to verify functional activity of recombinant S. wolfei lspA:

  • Globomycin resistance assay: Overexpression of S. wolfei lspA in E. coli confers increased resistance to globomycin, a specific inhibitor of SPase II . This method measures bacterial growth in the presence of increasing globomycin concentrations (typically 12.5-200 μg/ml). Statistical significance is determined using Student's t-test (p < 0.05) .

  • Genetic complementation assay: Temperature-sensitive E. coli strain Y815 (defective in lspA) is transformed with recombinant S. wolfei lspA and tested for growth restoration at non-permissive temperature (42°C) . Growth is quantitatively compared to control strains transformed with either empty vector (negative control) or E. coli lspA (positive control).

Research data indicates that while S. wolfei lspA confers globomycin resistance comparable to E. coli lspA, it restores growth in the complementation assay at approximately 20% of the efficiency observed with native E. coli lspA . This suggests that while the protein is functionally active, optimal performance may require species-specific interactions within the lipoprotein processing pathway.

How does the expression of lspA vary during different stages of S. wolfei growth?

Transcriptional analysis using quantitative reverse transcription-PCR (qRT-PCR) reveals that lspA expression in S. wolfei follows a distinct pattern during growth stages, similar to what has been observed in Rickettsia typhi . The expression pattern is characterized by:

  • High expression levels at pre-infection or early growth stages

  • Decreased expression during early to mid-log phase

  • Peak expression during late-log phase (approximately 48 hours)

  • Decreased expression during stationary phase and cell lysis

This expression pattern is closely mirrored by lgt (encoding prolipoprotein diacylglyceryl transferase), reflecting their coordinated function in lipoprotein processing . Interestingly, lepB (encoding Type I signal peptidase) consistently shows higher expression levels than both lspA and lgt, suggesting its broader role in processing non-lipoprotein secretory proteins .

The synchronized expression of lspA and lgt followed by their coordinated decrease suggests a regulatory mechanism that controls lipoprotein processing based on growth stage and metabolic requirements .

What is the relationship between lspA activity and post-translational modifications in S. wolfei?

Recent proteomic research has revealed extensive post-translational modifications (PTMs) in S. wolfei proteins, particularly acylation of lysine residues . These modifications correspond directly to reactive acyl-CoA species (RACS) produced during fatty acid degradation pathways . Six types of acylations have been identified in S. wolfei proteins: acetyl-, butyryl-, 3-hydroxybutyryl-, crotonyl-, valeryl-, and hexanyl-lysine modifications .

While no direct evidence links lspA to these PTMs, the role of lspA in processing lipoproteins represents an upstream event in the protein modification pathway that may influence subsequent acylation patterns . Research indicates that:

  • The acylation profile changes significantly with carbon substrate

  • A total of 369 modification sites have been identified on 237 proteins

  • Acylated proteins include key metabolic enzymes whose abundance remains stable across growth conditions

These findings suggest that S. wolfei may regulate its metabolism post-translationally, potentially as an energy-saving adaptation for its syntrophic lifestyle . The relationship between lspA-processed lipoproteins and subsequent acylation merits further investigation as a potential regulatory mechanism.

How does the lipid composition of S. wolfei membranes influence lspA function?

The membrane phospholipid profile of S. wolfei provides important context for understanding lspA function. Analysis reveals that S. wolfei contains predominantly:

  • Monounsaturated fatty acids: 16:1ω7c and 16:1ω9c

  • Saturated fatty acids: 16:0 and 14:0

  • Low concentrations of diunsaturated 18:2ω6

This lipid composition is significant for lspA function because:

  • The SPase II enzyme encoded by lspA is membrane-embedded and its activity is influenced by membrane fluidity

  • The predominance of monounsaturated phospholipids creates a membrane environment with intermediate fluidity

  • This lipid profile differs significantly from syntrophic partner organisms like Desulfovibrio sp., which contains higher percentages (20-23%) of branched-chain phospholipids

The distinct lipid composition may represent an adaptation to optimize membrane-bound enzyme functions, including lspA activity, in the energy-limited conditions under which S. wolfei operates . This lipid profile can serve as a biomarker for detecting S. wolfei in environmental samples without cultivation .

What techniques can be used to study the interaction between S. wolfei lspA and its substrate prolipoproteins?

Several advanced techniques can elucidate the interaction between lspA and its substrate prolipoproteins:

  • Surface Plasmon Resonance (SPR): Purified recombinant lspA can be immobilized on a sensor chip while prolipoprotein substrates flow across the surface. This allows real-time measurement of binding kinetics and affinity constants.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linkers can capture transient lspA-substrate interactions, followed by digestion and LC-MS/MS analysis to identify interaction sites.

  • Molecular dynamics simulations: Based on the S. wolfei lspA sequence and conserved domains identified through alignment analysis , computational models can predict substrate binding pocket configurations and catalytic mechanisms.

  • Site-directed mutagenesis: Targeted mutations of conserved residues (particularly the catalytic aspartate residues identified in other SPase II enzymes) can verify their importance in substrate recognition and processing.

  • Synthetic substrate assays: Fluorogenic peptide substrates mimicking the signal peptide cleavage site can be used for kinetic analysis of wild-type and mutant lspA variants.

These methods would build upon existing functional assays (globomycin resistance and genetic complementation) to provide mechanistic insights into substrate specificity and catalytic efficiency .

How can researchers investigate the role of lspA in S. wolfei's syntrophic metabolism with methanogenic partners?

The syntrophic metabolism of S. wolfei with methanogenic partners represents a complex ecological interaction that depends on proper membrane function, where lspA-processed lipoproteins may play crucial roles. To investigate this:

  • Co-culture proteomics: Compare protein expression profiles of S. wolfei grown in pure culture versus co-culture with methanogens like Methanospirillum hungatei using techniques such as:

    • Blue Native PAGE to analyze membrane protein complexes

    • Differential proteomics to identify proteins specifically expressed during syntrophic growth

    • Targeted proteomics (MRM-MS) to quantify lspA and processed lipoproteins

  • Conditional gene knockdown: While genetic manipulation of S. wolfei remains challenging, antisense RNA or CRISPR interference techniques could potentially reduce lspA expression to evaluate effects on:

    • Syntrophic growth rates

    • Interspecies electron transfer efficiency

    • Membrane integrity during syntrophic growth

  • Membrane vesicle analysis: Isolate membrane vesicles from S. wolfei during syntrophic and pure culture growth to compare:

    • Lipoprotein content and modification status

    • Electron transfer capabilities

    • Interspecies signaling molecules

Research has shown that S. wolfei relies on specialized membrane complexes for reverse electron transfer during syntrophic growth, including membrane-bound hydrogenases (Hyd2) and iron-sulfur oxidoreductases that are differentially expressed during syntrophic growth . The role of lspA-processed lipoproteins in assembling or regulating these complexes represents an important area for investigation.

What are the methodological challenges in producing and analyzing functional recombinant S. wolfei lspA?

Producing functional recombinant S. wolfei lspA presents several methodological challenges:

  • Membrane protein expression issues:

    • lspA is a membrane-embedded enzyme requiring proper folding and insertion

    • Expression in E. coli may result in inclusion body formation or misfolding

    • Solubilization requires careful detergent selection to maintain activity

  • Purification challenges:

    • Maintaining enzyme stability during purification

    • Removing detergents without causing aggregation

    • Verifying proper folding of purified protein

  • Activity measurement limitations:

    • Natural substrates (prolipoproteins) are difficult to isolate in native form

    • Synthetic substrate assays may not fully recapitulate native activity

    • In vitro conditions may not replicate the anaerobic, energy-limited environment

  • Structural analysis difficulties:

    • Membrane proteins are challenging for crystallization

    • NMR analysis is complicated by size and membrane association

    • Cryo-EM may require larger protein complexes for optimal resolution

  • Functional validation approaches:

    • Complementation assays show significant but reduced activity (approximately 20% of E. coli lspA efficiency)

    • Globomycin resistance assays demonstrate function but may not reflect native substrate processing

    • The optimal temperature and pH for enzyme activity may differ from E. coli growth conditions

Researchers should consider using specialized membrane protein expression systems, fusion partners to enhance solubility, and nanodisc reconstitution for functional studies in a membrane-like environment .

How does S. wolfei lspA function compare with other bacterial Type II signal peptidases in terms of substrate specificity?

Comparative analysis of S. wolfei lspA with other bacterial Type II signal peptidases reveals important insights into substrate specificity:

  • In silico prediction analysis: Using SignalP (version 3.0) and LipoP (version 1.0) tools on the S. wolfei genome identifies potential lipoprotein substrates. Similar analysis of the R. typhi genome identified 14 lipoproteins out of 89 total secretory proteins , providing a comparison point.

  • Consensus sequence recognition: The lipobox motif [LVI][ASTVI][GAS][C] preceding the cleavage site is the primary determinant of substrate recognition. S. wolfei lspA likely processes a lipobox similar to other SPase II enzymes, though subtle species-specific preferences may exist .

  • Functional conservation despite sequence divergence: Despite only 22% sequence identity with E. coli lspA, the S. wolfei enzyme confers significant globomycin resistance when expressed in E. coli, indicating functional conservation of substrate recognition domains .

  • Metabolic context influences: The specialized metabolic lifestyle of S. wolfei as a syntrophic fatty acid degrader likely shapes its lipoprotein requirements. The 14 predicted lipoproteins in the related R. typhi suggest a relatively limited but specialized set of substrates compared to free-living bacteria .

  • Complementation efficiency: The lower complementation efficiency of S. wolfei lspA in E. coli (approximately 20% of native enzyme) suggests differences in optimal processing conditions or subtle substrate preferences that have evolved to match the specific membrane environment and lipoprotein requirements of S. wolfei .

What role might lspA play in the post-translational acylation landscape observed in S. wolfei?

Recent research has uncovered an extensive and dynamic acylation landscape in S. wolfei proteins, with potential connections to lspA function:

  • Reactive acyl-CoA species (RACS) generated during fatty acid metabolism directly correspond to the types of protein acylations observed (acetyl-, butyryl-, 3-hydroxybutyryl-, crotonyl-, valeryl-, and hexanyl-lysine) .

  • Carbon substrate-specific modifications: The pattern of acylation changes dramatically with carbon substrate, suggesting metabolic regulation through PTMs . This table summarizes the relationship between carbon substrates and observed acylations:

Carbon SubstratePredominant Acylation TypesUnique Modifications
ButyrateAcetyl-, butyryl-, 3-hydroxybutyryl-None
CrotonateAcetyl-, butyryl-, crotonyl-Crotonyl-lysine
ValerateAcetyl-, propionyl-, valeryl-Valeryl-lysine
HexanoateAcetyl-, butyryl-, hexanyl-Hexanyl-lysine
  • Potential regulatory mechanisms: lspA processes lipoproteins that may subsequently undergo acylation modifications. This sequential processing could represent a sophisticated regulatory system where:

    • lspA processes specific lipoproteins needed for fatty acid metabolism

    • These lipoproteins become substrates for subsequent acylation

    • Acylation status influences protein function in response to metabolic conditions

  • Energy conservation hypothesis: In the energy-limited environment where S. wolfei operates, post-translational modification through acylation may represent an energy-efficient alternative to protein turnover . lspA-processed lipoproteins may be particularly important targets for this regulatory mechanism.

  • Experimental approaches: To investigate the relationship between lspA and acylation, researchers could:

    • Compare acylation patterns of lipoproteins versus non-lipoproteins

    • Examine whether lspA processing is a prerequisite for certain acylation events

    • Determine if alterations in lspA expression affect the global acylation landscape

How might genome-scale metabolic modeling incorporate lspA function to better understand S. wolfei's syntrophic lifestyle?

Integrating lspA function into genome-scale metabolic models presents an opportunity to better understand S. wolfei's unique syntrophic lifestyle:

  • Model components to include:

    • Energy requirements for lipoprotein processing

    • Membrane-associated electron transfer systems

    • Lipoprotein-dependent metabolic pathways

    • Growth stage-dependent expression patterns

  • Data integration approaches:

    • Transcriptomic data showing differential expression of lspA, lgt, and lepB during growth

    • Proteomic data identifying membrane complexes involved in reverse electron transfer

    • Acylome data revealing post-translational modification landscapes

    • Genomic data identifying specialized features like multiple β-oxidation gene homologs

  • Key model constraints:

    • Thermodynamic limitations of syntrophic metabolism

    • Energy conservation requirements in reverse electron transfer

    • Membrane space constraints for protein complexes

    • Regulatory effects of metabolite-driven acylation

  • Research findings to incorporate:

    • S. wolfei lacks genes for aerobic/anaerobic respiration and has limited ability to create ion gradients

    • Multiple homologs exist for β-oxidation genes despite limited substrate range

    • Formate and hydrogen production may involve electron bifurcation mechanisms

    • Membrane-bound iron-sulfur oxidoreductase may be uniquely involved in reverse electron transport

  • Model validation approaches:

    • Growth rate predictions under different syntrophic partnerships

    • Metabolic flux analysis comparing pure culture and syntrophic growth

    • Predictions of conditional essentiality for lspA and other lipoprotein processing genes

    • Sensitivity analysis for energy requirements of membrane protein systems

By incorporating lspA function into these models, researchers can better understand how S. wolfei optimizes its energy-limited metabolism and maintains the delicate balance required for syntrophic growth .

What are the most promising future research directions for understanding S. wolfei lspA function in syntrophic metabolism?

Several high-potential research directions emerge from current understanding of S. wolfei lspA:

  • Identification of the complete lipoprotein secretome: Comprehensive identification of all lipoproteins processed by lspA would provide insights into its biological role. This could be accomplished through:

    • Improved bioinformatic prediction tools specifically trained on syntrophic bacteria

    • Global lipidomic and proteomic analysis of membrane fractions

    • Pulse-chase labeling with lipid precursors to track newly processed lipoproteins

  • Investigation of regulatory mechanisms: Understanding how lspA expression and activity are regulated could reveal adaptation mechanisms. Approaches include:

    • Promoter analysis and identification of transcription factors

    • Characterization of post-translational modifications of lspA itself

    • Investigation of potential feedback inhibition by processed lipoproteins

  • Development of genetic tools for S. wolfei: Creating systems for genetic manipulation would enable in vivo functional studies through:

    • Optimization of transformation protocols for this anaerobic syntrophic bacterium

    • Development of inducible expression systems

    • CRISPR-based genome editing techniques adapted for anaerobes

  • Structure-function analysis: Determining the three-dimensional structure of S. wolfei lspA would provide insights into:

    • Substrate binding determinants

    • Catalytic mechanism details

    • Membrane integration and topology

    • Rational design of specific inhibitors for functional studies

  • Systems biology integration: Incorporating lspA function into broader metabolic and regulatory networks would help understand:

    • How lipoprotein processing integrates with energy conservation mechanisms

    • The role of processed lipoproteins in interspecies electron transfer

    • Adaptation of membrane functions during shifts between pure culture and syntrophic growth

These research directions would build upon existing knowledge while addressing key gaps in understanding this essential enzyme's function in syntrophic metabolism .

What technological advances would most benefit research on S. wolfei lspA and related signal peptidases?

Several technological advances would significantly enhance research on S. wolfei lspA:

  • Improved membrane protein structural analysis tools:

    • Advanced lipid nanodiscs for membrane protein reconstitution

    • Cryo-EM methods optimized for smaller membrane proteins

    • Computational approaches for predicting membrane protein interactions

  • Enhanced genetic manipulation systems for syntrophic anaerobes:

    • Anaerobic transformation protocols with higher efficiency

    • Shuttle vectors optimized for Syntrophomonas species

    • Inducible promoter systems functional in energy-limited conditions

    • CRISPR-Cas systems adapted for obligate anaerobes

  • Advanced microscopy techniques:

    • Super-resolution microscopy under strict anaerobic conditions

    • Single-molecule tracking of fluorescently tagged lipoproteins

    • Correlative light and electron microscopy for visualizing membrane organization

  • Specialized mass spectrometry approaches:

    • Improved methods for membrane protein analysis

    • Enhanced sensitivity for detecting low-abundance lipoproteins

    • Cross-linking mass spectrometry optimized for membrane protein complexes

    • Advanced acylation site mapping technologies

  • Synthetic biology and protein engineering tools:

    • Cell-free expression systems for membrane proteins

    • Split reporter assays for monitoring protein-protein interactions in anaerobes

    • Directed evolution approaches for studying lspA function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.