Recombinant Syntrophus aciditrophicus ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
ftsH; SYNAS_19360; SYN_03643; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-736
Protein Length
full length protein
Species
Syntrophus aciditrophicus (strain SB)
Target Names
ftsH
Target Protein Sequence
MDSNVDSQRVPDGQIFFRPVHPGISGKDMESGTSDGQQRKMMEFEISEEADMRLTRQQTQ NRTGFASADTKQGSPEGADRKKMPPGKAWLWFVLILIVNFLMVRLLIPDAEQPVMVPYTL FKGEVGKGNVKEIFSRGDTITGRFKEEIAYQAAEEKAGDSRKASKAVTTFTTTVPSFVDP GLEAFLISNGVEISAKPIHEERSPWATIVYSFGPGLLFIAFYIWLFRRMAQQGGLGGGIM GIGKSKARRYDQEEGRKVTFDDVAGIDEAENELVEIVDFLKDPPKYTRLGGTAPKGVLLV GAPGTGKTLLAKAVAGEAGVPFFSMSAAEFVEMIVGVGAARVRDLFKQAREHAPAIIFID ELDAIGRARGQVAIGGASEQEQTLNQILTEMDGFSSREGIIVLAATNQPDVLDKALLRPG RFDRRVVVNLPDKVGREAILKVHTRSVPLAKDASLGELAAATPGFSGADLRNLVNEAALM AARRDQDDVRARDFLDALEKIVLGPERPLLLSHADKERIAYHEGGHAILGLVAHGADRVH RVTIVPRGQALGVTYQRPDSDRYNYTEAYLRAKIVGMLGGRAAEEIVYGTRTTGAESDIE QATGLAHRMVTRWGMSERLGLIQLAPRENPYLGGPAGYGSARPFSDGTAEAIDAEVIRII AESHEEAKRLLRAYRKQLDVLAEALVAQETLDEQEILRITGLPPAPALDAGKLPVPDGGD KNAEPSVSLPGVAGPS
Uniprot No.

Target Background

Function
This recombinant *Syntrophus aciditrophicus* ATP-dependent zinc metalloprotease FtsH functions as a processive, ATP-dependent zinc metallopeptidase, targeting both cytoplasmic and membrane proteins. It plays a critical role in the quality control of integral membrane proteins.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is Syntrophus aciditrophicus and why is its FtsH protein significant for research?

Syntrophus aciditrophicus is a syntrophic bacterium that plays a crucial role in the degradation of organic compounds in anaerobic environments. It is known for its ability to syntrophically degrade benzoate and cyclohexane-1-carboxylate and can catalyze the novel synthesis of these compounds from crotonate . The ATP-dependent zinc metalloprotease FtsH in S. aciditrophicus is a membrane-bound AAA+ protease that is significant for research because it participates in protein quality control and regulation of various cellular processes. Understanding FtsH function provides insights into the unique adaptations that enable S. aciditrophicus to thrive in syntrophic relationships.

The currently available recombinant form is a full-length protein (736 amino acids) with an N-terminal His-tag, expressed in E. coli . This recombinant protein enables researchers to study the structural and functional properties of this enzyme outside its native context.

How is recombinant S. aciditrophicus FtsH properly stored and reconstituted?

For successful experimental work with recombinant S. aciditrophicus FtsH, proper storage and reconstitution are essential:

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot and store at -20°C/-80°C

The protein is supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

What experimental approaches are recommended for assessing the ATPase activity of recombinant S. aciditrophicus FtsH?

The ATPase activity of recombinant S. aciditrophicus FtsH can be measured using several complementary approaches:

Method 1: Colorimetric phosphate release assay

  • Prepare reaction mixture containing purified FtsH (0.1-1 μM), ATP (1-5 mM), MgCl₂ (5-10 mM), and appropriate buffer (typically HEPES or Tris at pH 7.5-8.0)

  • Incubate at 30-37°C for defined time intervals

  • Quantify released inorganic phosphate using malachite green or molybdate-based colorimetric assays

  • Calculate specific activity as μmol Pi released per minute per mg protein

Method 2: Coupled enzyme assay

  • Use a coupled enzyme system with pyruvate kinase and lactate dehydrogenase

  • Monitor NADH oxidation at 340 nm as a direct measure of ATP hydrolysis

  • Calculate ATPase activity based on the rate of absorbance decrease

When designing ATPase activity experiments, researchers should consider:

  • The requirement for divalent cations (typically Mg²⁺)

  • Potential effects of detergents if working with the full-length membrane protein

  • The importance of substrate proteins in stimulating ATPase activity

  • Temperature and pH dependence of the enzyme

How does S. aciditrophicus FtsH compare to FtsH homologs from other organisms?

While specific comparative data for S. aciditrophicus FtsH is limited, important insights can be drawn from examining sequence similarities and differences with other bacterial FtsH proteins.

The S. aciditrophicus FtsH belongs to the AAA+ (ATPases Associated with diverse cellular Activities) superfamily of proteins, which are characterized by conserved Walker A and B motifs for ATP binding and hydrolysis. Based on its amino acid sequence, S. aciditrophicus FtsH shows the typical domain organization of bacterial FtsH proteins, including:

  • N-terminal transmembrane domains that anchor the protein to the membrane

  • AAA+ ATPase domain containing Walker A (GAPGTGKT) and Walker B motifs

  • Zinc-binding metalloprotease domain with the HEXXH motif

A comparative approach to studying S. aciditrophicus FtsH would include:

  • Sequence alignment with well-characterized FtsH proteins from model organisms

  • Phylogenetic analysis to understand evolutionary relationships

  • Structural modeling based on solved crystal structures of other FtsH proteins

  • Functional complementation studies in FtsH-deficient bacterial strains

What methodologies can be employed to identify the substrate specificity of S. aciditrophicus FtsH?

Determining the substrate specificity of S. aciditrophicus FtsH requires multiple experimental approaches:

Method 1: In vitro degradation assays

  • Purify recombinant S. aciditrophicus FtsH to >90% homogeneity

  • Select candidate substrate proteins based on known FtsH substrates in other bacteria

  • Incubate FtsH with candidate substrates in the presence of ATP and Mg²⁺

  • Monitor proteolysis by SDS-PAGE, Western blotting, or fluorescence-based assays

Method 2: Proteomics-based identification of substrates

  • Perform comparative proteomics between wild-type S. aciditrophicus and FtsH-deficient mutants

  • Identify proteins that accumulate in the absence of FtsH activity

  • Validate candidate substrates using in vitro degradation assays

Method 3: Peptide library screening

  • Use combinatorial peptide libraries to identify sequence motifs recognized by the protease domain

  • Synthesize fluorogenic peptide substrates containing identified motifs

  • Measure proteolytic activity using fluorescence-based assays

Data table: Expected characteristics of potential S. aciditrophicus FtsH substrates

PropertyExpected FeatureExperimental Verification
Sequence MotifsHydrophobic residues at C-terminusMutational analysis of substrate proteins
Structural FeaturesExposed degradation tagsStructural analysis by CD or NMR
Cellular LocalizationMembrane-associated or cytoplasmicCell fractionation studies
Physiological RoleInvolved in stress response or protein quality controlGrowth phenotypes in varying conditions
Degradation KineticsATP-dependent proteolysisTime-course degradation assays

What is the role of FtsH in the syntrophic lifestyle of S. aciditrophicus?

S. aciditrophicus is known for its syntrophic lifestyle, where it metabolizes organic compounds in cooperation with hydrogen-consuming microorganisms like Methanospirillum hungatei . The role of FtsH in this syntrophic relationship can be investigated through several approaches:

Research Approach 1: Comparative proteomics under syntrophic vs. non-syntrophic conditions

  • Grow S. aciditrophicus in pure culture on crotonate and in coculture with M. hungatei on benzoate or cyclohexane-1-carboxylate

  • Compare protein expression profiles, focusing on FtsH abundance

  • Correlate FtsH expression with the expression of other proteins involved in syntrophic metabolism

S. aciditrophicus uses the same core set of enzymes for both degradation and synthesis of benzoate and cyclohexane-1-carboxylate . FtsH may play a role in regulating the abundance and activity of these bidirectional metabolic pathways through selective proteolysis.

Research Approach 2: Genetic manipulation studies

  • Generate FtsH knockdown or conditional mutants in S. aciditrophicus

  • Assess the impact on syntrophic growth with M. hungatei

  • Determine effects on the expression and stability of key metabolic enzymes

While specific data on the role of FtsH in S. aciditrophicus's syntrophic lifestyle is not directly provided in the search results, researchers can draw inferences from the important role FtsH plays in other bacteria in:

  • Regulating membrane protein quality

  • Stress response adaptation

  • Energy metabolism regulation

How can recombinant S. aciditrophicus FtsH be used in structural studies?

Structural studies of recombinant S. aciditrophicus FtsH can provide valuable insights into its mechanism of action. Several approaches are recommended:

Method 1: X-ray crystallography

  • Optimize the purification protocol to obtain highly homogeneous protein (>95% purity)

  • Screen various buffer conditions, detergents (for full-length protein), and additives to identify crystallization conditions

  • Consider using substrate analogs or non-hydrolyzable ATP analogs to capture different conformational states

  • For improved crystallization, remove flexible regions or use only the catalytic domains

Method 2: Cryo-electron microscopy (Cryo-EM)

  • Purify the hexameric assembly of FtsH in a homogeneous state

  • Prepare samples on EM grids in the presence of ATP/ADP and substrate proteins

  • Collect high-resolution images and perform single-particle analysis

  • Generate 3D reconstructions to visualize different conformational states

Method 3: Small-angle X-ray scattering (SAXS)

  • Use SAXS to obtain low-resolution structural information in solution

  • Compare the structure in different nucleotide-bound states

  • Analyze conformational changes upon substrate binding

Considerations for structural studies:

  • The membrane domains may require specialized approaches such as detergent solubilization or nanodiscs

  • Constructs lacking the transmembrane domains may be more amenable to crystallization

  • ATP hydrolysis can lead to conformational heterogeneity; consider using ATPγS or other non-hydrolyzable ATP analogs

What are the common challenges in expressing and purifying recombinant S. aciditrophicus FtsH?

Expressing and purifying membrane-associated AAA+ proteases like FtsH presents several challenges that researchers should anticipate:

Challenge 1: Protein solubility and aggregation

  • FtsH contains transmembrane domains that can cause aggregation when expressed in E. coli

  • Solution: Use mild detergents (DDM, LDAO) during cell lysis and purification, or express only the soluble domains

Challenge 2: Proteolytic activity during expression

  • Active FtsH may degrade host cell proteins, affecting cell viability and protein yield

  • Solution: Use inducible expression systems with tight regulation, lower induction temperature (16-20°C), or express catalytically inactive mutants

Challenge 3: Maintaining the hexameric assembly

  • FtsH functions as a hexamer, which may dissociate during purification

  • Solution: Include ATP or non-hydrolyzable ATP analogs in purification buffers to stabilize the oligomeric state

Challenge 4: Protein yield and purity

  • Full-length membrane proteins often express at lower levels

  • Solution: Optimize codon usage for E. coli, use specialized expression strains (C41/C43), and implement multi-step purification strategies

Data table: Optimization strategies for recombinant S. aciditrophicus FtsH expression

ParameterOptions to TestExpected Outcome
Expression HostBL21(DE3), C41(DE3), C43(DE3), RosettaIdentify strain with highest soluble expression
Induction Temperature37°C, 30°C, 25°C, 18°CLower temperatures often improve folding
Induction Duration3h, 6h, overnight, 24hDetermine optimal expression time
IPTG Concentration0.1 mM, 0.5 mM, 1.0 mMOptimize inducer concentration
AdditivesGlycerol (5-10%), NaCl (100-500 mM)Enhance protein stability
DetergentsDDM, LDAO, Triton X-100Identify optimal detergent for solubilization

How can site-directed mutagenesis be used to investigate the catalytic mechanism of S. aciditrophicus FtsH?

Site-directed mutagenesis is a powerful approach to dissect the functional importance of specific residues in S. aciditrophicus FtsH:

Step 1: Identify key residues for mutagenesis

  • Select conserved residues in the Walker A motif (GAPGTGKT) essential for ATP binding

  • Target the Walker B motif involved in ATP hydrolysis

  • Mutate the HEXXH motif in the protease domain required for zinc coordination and catalysis

  • Identify residues potentially involved in substrate recognition

Step 2: Design appropriate mutations

  • Conservative mutations (e.g., K→R, E→D) to maintain charge but alter function

  • Non-conservative mutations (e.g., K→A, H→A) to completely abolish function

  • Create double or triple mutants to investigate cooperativity between residues

Step 3: Functional characterization of mutants

  • Compare ATPase activity of wild-type and mutant proteins

  • Assess proteolytic activity using model substrates

  • Determine oligomerization state by size exclusion chromatography

  • Measure conformational changes upon nucleotide binding using fluorescence spectroscopy

Expected outcomes from key mutations:

DomainResidue MotifMutationExpected Phenotype
ATPaseWalker A (GXXGXGKT)K→ADefective ATP binding
ATPaseWalker B (DEID)E→QATP binding but defective hydrolysis
ProteaseHEXXHH→A, E→ALoss of proteolytic activity
SensorArginine fingerR→ADefective intersubunit communication

What approaches can be used to investigate the interaction between S. aciditrophicus FtsH and its substrates?

Understanding how S. aciditrophicus FtsH recognizes and processes its substrates requires multiple complementary approaches:

Method 1: Binding studies

  • Surface Plasmon Resonance (SPR) to measure binding kinetics between FtsH and potential substrates

  • Microscale Thermophoresis (MST) to quantify interactions in solution

  • Isothermal Titration Calorimetry (ITC) to determine thermodynamic parameters of binding

Method 2: Cross-linking and mass spectrometry

  • Use chemical cross-linkers to capture transient FtsH-substrate complexes

  • Perform mass spectrometry analysis to identify cross-linked residues

  • Map interaction sites onto structural models of FtsH and substrate proteins

Method 3: Fluorescence-based assays

  • Label substrates with environmentally sensitive fluorophores

  • Monitor changes in fluorescence upon binding to FtsH

  • Use FRET-based approaches to track substrate unfolding and translocation

Method 4: Computational docking and simulation

  • Generate structural models of S. aciditrophicus FtsH based on homology modeling

  • Perform in silico docking of potential substrate proteins

  • Use molecular dynamics simulations to investigate the dynamic aspects of interaction

How might S. aciditrophicus FtsH function in relation to the organism's unique reversible metabolism?

S. aciditrophicus possesses a remarkable ability to use the same enzymes for both the degradation and synthesis of compounds like benzoate and cyclohexane-1-carboxylate . This reversible metabolism represents a unique adaptation to the syntrophic lifestyle. FtsH might play a critical role in this process through:

Role 1: Regulation of bidirectional enzyme expression

  • FtsH could selectively degrade key regulatory proteins that control the directionality of metabolic pathways

  • Research approach: Compare the degradome of FtsH under conditions favoring anabolic versus catabolic reactions

Role 2: Quality control of enzymes involved in reversible pathways

  • Enzymes like BamR, BamQ, and BamA, which are highly abundant in S. aciditrophicus , might be substrates for FtsH-mediated quality control

  • Research approach: Investigate whether these enzymes accumulate as misfolded species in FtsH-deficient cells

Role 3: Adaptation to changes in syntrophic partners

  • FtsH might help S. aciditrophicus rapidly adapt to changes in hydrogen concentration or syntrophic partner availability

  • Research approach: Examine FtsH expression and activity during transitions between syntrophic and non-syntrophic growth conditions

The proteomic studies of S. aciditrophicus grown under different conditions have revealed a core set of enzymes used for both degradation and synthesis . Future research should investigate whether FtsH contributes to the regulation of these bidirectional pathways through selective proteolysis of key metabolic enzymes or regulatory proteins.

What emerging technologies could enhance our understanding of S. aciditrophicus FtsH function?

Several cutting-edge technologies offer promising avenues for deeper insights into S. aciditrophicus FtsH function:

Technology 1: Single-molecule techniques

  • Single-molecule FRET to visualize conformational changes during the ATP hydrolysis cycle

  • Optical tweezers to measure the force generated during substrate unfolding and translocation

  • These approaches can reveal heterogeneity in enzyme behavior obscured in bulk measurements

Technology 2: In-cell structural biology

  • Cryo-electron tomography to visualize FtsH in its native membrane environment

  • NMR-based approaches to study protein dynamics in near-native conditions

  • These methods provide structural information in the cellular context

Technology 3: Integrative multi-omics approaches

  • Combine transcriptomics, proteomics, and metabolomics to understand the system-level impact of FtsH

  • Use network analysis to identify functional connections between FtsH and other cellular processes

  • These strategies reveal the broader physiological roles of FtsH in S. aciditrophicus

Technology 4: CRISPR-based approaches

  • Develop CRISPR-Cas systems for precise genetic manipulation of S. aciditrophicus

  • Create conditional knockdowns or allelic variants of FtsH to study its function in vivo

  • These genetic tools enable direct testing of hypotheses about FtsH function

How can structural information about S. aciditrophicus FtsH inform the design of specific inhibitors for research purposes?

Structural information about S. aciditrophicus FtsH can guide the rational design of specific inhibitors that would serve as valuable research tools:

Strategy 1: Structure-based virtual screening

  • Generate a high-quality homology model of S. aciditrophicus FtsH based on crystal structures of homologous proteins

  • Identify potential binding pockets in the ATPase and protease domains

  • Screen virtual libraries of small molecules for compounds predicted to bind these pockets

  • Validate top hits with biochemical assays

Strategy 2: Fragment-based drug design

  • Screen libraries of low molecular weight fragments for binding to specific domains of FtsH

  • Use structural information to guide the elaboration of fragments into more potent compounds

  • Optimize compound properties for cell permeability and target specificity

Strategy 3: Peptide-based inhibitor design

  • Design peptides that mimic the recognition motifs of FtsH substrates

  • Incorporate non-hydrolyzable modifications to create competitive inhibitors

  • Cyclize peptides or incorporate non-natural amino acids to enhance stability

Strategy 4: Allosteric inhibitor development

  • Identify potential allosteric sites that could disrupt the coordination between ATPase and protease activities

  • Design compounds that lock FtsH in inactive conformations

  • Focus on interfaces between subunits in the hexameric assembly

Specific inhibitors would enable researchers to:

  • Selectively inhibit FtsH in living cells of S. aciditrophicus

  • Distinguish between ATPase and protease functions using domain-specific inhibitors

  • Study the physiological consequences of FtsH inhibition

  • Investigate the role of FtsH in syntrophic interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.