Recombinant Syntrophus aciditrophicus ATP synthase subunit b 1 (atpF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF1; SYNAS_06280; SYN_00548; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Syntrophus aciditrophicus (strain SB)
Target Names
atpF1
Target Protein Sequence
MKKSVWHHSLKGYCGRIAAVLCFSVLVPLVAMAAEGGGHGEEGTDWVNFGWRVLDFIILV GLFYWLLASKVKSFFSGRREEIKTTLEEARLAKEAAEHKFKEYSEKLDKASKEIEGVYEM IRAQGQAEKEKILEDARKAAAKMKEDTQARIEQELKKASQQLRMEAVQLSVHVAEDILKR NITPEDHQSMVKDYLDKVVRKH
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via the rotary mechanism of the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk that links F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the significance of ATP synthase in Syntrophus aciditrophicus compared to other bacteria?

Syntrophus aciditrophicus employs a unique approach to ATP synthesis that differs significantly from conventional bacterial mechanisms. While most bacteria utilize phosphate acetyltransferase and acetate kinase to synthesize ATP from acetyl coenzyme A (CoA) and phosphate, S. aciditrophicus lacks homologs for these enzymes in its genome . Instead, S. aciditrophicus employs AMP-forming acetyl-CoA synthetase (Acs1) for ATP synthesis from acetyl-CoA . This distinctive mechanism represents an alternative evolutionary strategy for energy conservation and highlights the metabolic versatility that enables S. aciditrophicus to thrive in syntrophic relationships within anaerobic environments.

To investigate this system experimentally, researchers should consider employing combined transcriptomic, proteomic, metabolite, and enzymatic approaches as demonstrated in previous studies . Specifically, measuring enzyme activities in cell extracts and analyzing pyrophosphate levels alongside AMP-to-ATP ratios provides crucial evidence for determining the direction of acetyl-CoA metabolism.

How does the structure of ATP synthase in S. aciditrophicus compare to the canonical F1F0-ATP synthase?

When designing experiments to investigate structural differences, researchers should consider:

  • Purifying the native enzyme complex using non-denaturing techniques

  • Employing comparative proteomic analysis between S. aciditrophicus and model organisms

  • Utilizing structural biology approaches like cryo-electron microscopy to resolve subunit arrangements

  • Analyzing post-translational modifications that might impact function

What methodological approaches are most effective for expressing and purifying recombinant S. aciditrophicus ATP synthase subunit b 1?

Successful expression and purification of recombinant S. aciditrophicus ATP synthase subunit b 1 requires careful consideration of expression systems and purification strategies. When working with membrane proteins like ATP synthase subunits, researchers should consider:

  • Expression system selection:

    • E. coli-based systems with specialized strains designed for membrane protein expression

    • Cell-free expression systems for potentially toxic proteins

    • Inducible promoters for fine control of expression levels

  • Purification strategy:

    • Detergent screening for optimal solubilization

    • Affinity chromatography using engineered tags

    • Size exclusion chromatography for final polishing

  • Functional verification:

    • ATPase activity assays before and after reconstitution

    • Analysis of oligomeric state by native gel electrophoresis

    • Structural integrity assessment through circular dichroism

How does ATP synthase in S. aciditrophicus contribute to the organism's ability to catalyze both degradative and synthetic reactions?

S. aciditrophicus demonstrates remarkable metabolic versatility by utilizing the same enzymatic pathways for both degradation and synthesis of compounds like benzoate and cyclohexane-1-carboxylate . This bidirectional metabolism suggests a unique role for ATP synthase in maintaining energy balance during these reversible processes.

Experimental evidence indicates that S. aciditrophicus employs the same enzymes in both directions of metabolism, particularly those involved in processing cyclohex-1,5-diene carboxyl-CoA to acetyl-CoA . These enzymes were detected in high abundance regardless of growth conditions, whether in pure culture on crotonate or in coculture with Methanospirillum hungatei on various substrates .

To investigate the role of ATP synthase in this metabolic flexibility, researchers should:

  • Conduct comparative proteomic analyses under different growth conditions

  • Employ stable isotope metabolomics to trace carbon flow

  • Perform gene knockdown or protein inhibition studies to assess functional impact

  • Measure intracellular ATP/ADP ratios during substrate utilization shifts

What is the relationship between pyrophosphate metabolism and ATP synthase function in S. aciditrophicus?

S. aciditrophicus has evolved a pyrophosphate-dependent mechanism for ATP formation that represents a significant departure from conventional energy conservation strategies. The enzyme Acs1 (acetyl-CoA synthetase) catalyzes ATP and acetate formation from acetyl-CoA, AMP, and pyrophosphate . This mechanism is supported by high pyrophosphate levels and elevated AMP-to-ATP ratios (measured at 5.9 ± 1.4) within S. aciditrophicus cells .

This pyrophosphate-dependent ATP formation mechanism may be particularly advantageous in energy-limited syntrophic environments. When designing experiments to investigate this relationship, researchers should:

  • Measure intracellular pyrophosphate concentrations under different growth conditions

  • Investigate enzymes involved in pyrophosphate generation and consumption

  • Assess the impact of pyrophosphate analogs on ATP synthesis

  • Evaluate the thermodynamics of the Acs1-catalyzed reaction under physiologically relevant conditions

How do ATP hydrolysis inhibition mechanisms in S. aciditrophicus compare to those in other organisms?

ATP synthase can function bidirectionally, either synthesizing ATP or hydrolyzing it depending on cellular conditions. In many organisms, the ATPase Inhibitory Factor 1 (ATPIF1) prevents wasteful ATP hydrolysis by binding to the F1 head of ATP synthase between the α and β subunits' α-helices .

While specific data on ATP hydrolysis inhibition in S. aciditrophicus is limited, we can infer potential mechanisms based on comparative studies. In mitochondrial systems, the ATPIF1 N-terminal region reaches the γ subunit of the central stalk, preventing complete rotation of ATP synthase and blocking both synthesis and hydrolysis .

For experimental investigation of potential inhibitory mechanisms in S. aciditrophicus, researchers should consider:

  • Genomic analysis to identify potential inhibitory protein homologs

  • Proteomic studies under varying energy conditions to detect regulatory proteins

  • In vitro ATP hydrolysis assays with potential inhibitors

  • Structural studies of the ATP synthase F1 domain to identify binding sites for inhibitory factors

What experimental approaches can resolve contradictory data regarding S. aciditrophicus metabolic pathways?

To resolve such contradictions in metabolic pathway research, scientists should employ:

  • Multi-omics approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Use stable isotope labeling to track metabolic flux

    • Perform comparative genomics across related organisms

  • Enzyme characterization:

    • Express and purify key enzymes for in vitro activity assays

    • Conduct substrate specificity studies

    • Perform inhibition studies to validate pathways

  • Genetic manipulation:

    • Develop gene knockout or knockdown systems

    • Employ heterologous expression to evaluate enzyme function

    • Use CRISPR-Cas9 for precise genome editing when feasible

What are the optimal conditions for assaying ATP synthase activity in purified S. aciditrophicus preparations?

Accurate measurement of ATP synthase activity in S. aciditrophicus requires careful consideration of assay conditions. Based on the unique pyrophosphate-dependent mechanism employed by this organism, researchers should optimize:

  • Buffer composition:

    • pH range (typically 6.5-7.5 for optimal activity)

    • Ionic strength (150-300 mM KCl or NaCl)

    • Divalent cation concentration (usually 2-5 mM Mg²⁺)

  • Substrate concentrations:

    • AMP (0.1-2 mM)

    • Pyrophosphate (0.5-5 mM)

    • Acetyl-CoA (0.1-1 mM)

  • Measurement approaches:

    • Coupled enzyme assays for real-time monitoring

    • HPLC-based separation and quantification of nucleotides

    • ³²P-labeled substrate incorporation for high sensitivity

Data from cell extracts indicate that S. aciditrophicus exhibits high acetyl-CoA synthetase activity under various growth conditions, with minimal or undetectable acetate kinase and phosphate acetyltransferase activities . This suggests that optimal assay design should focus on the Acs1-catalyzed reaction.

How can researchers effectively differentiate between ATP synthesis and hydrolysis activities in S. aciditrophicus preparations?

Distinguishing between ATP synthesis and hydrolysis activities presents a significant experimental challenge. Since ATP synthase can operate bidirectionally, researchers need methodological approaches that can definitively determine the direction of the reaction.

Effective experimental strategies include:

  • Direction-specific assays:

    • For synthesis: Monitor formation of ATP from AMP, pyrophosphate, and acetyl-CoA

    • For hydrolysis: Measure AMP and pyrophosphate production from ATP and acetate

  • Thermodynamic control:

    • Manipulate reactant/product ratios to favor desired direction

    • Use pH gradients to influence reaction equilibrium

    • Apply membrane potential when working with membrane preparations

  • Use of specific inhibitors:

    • Apply compounds that selectively inhibit either synthesis or hydrolysis

    • Consider natural inhibitors like ATPIF1 homologs or synthetic analogs

A potentially valuable approach is the Hydrolysis in Frozen Samples (HyFS) method, which allows measurement of maximal ATP hydrolysis by Complex V in previously frozen samples .

What considerations are important when designing experiments to study the impact of environmental conditions on ATP synthase expression and activity?

S. aciditrophicus inhabits energy-limited anaerobic environments and grows syntrophically with hydrogen-consuming partners. When designing experiments to evaluate environmental impacts on ATP synthase expression and activity, researchers should consider:

  • Culture conditions:

    • Pure culture versus coculture with metabolic partners (e.g., Methanospirillum hungatei)

    • Substrate availability (crotonate, benzoate, cyclohexane-1-carboxylate)

    • Growth phase (exponential versus stationary)

  • Environmental variables:

    • pH (typically 6.0-7.5 for anaerobic syntrophs)

    • Temperature (mesophilic range, typically 30-37°C)

    • Partial pressure of hydrogen (critical for syntrophic growth)

  • Analytical approaches:

    • qRT-PCR for gene expression analysis

    • Western blotting for protein quantification

    • Enzyme activity assays under various conditions

    • Metabolite profiling to assess energetic state

Previous research has demonstrated that S. aciditrophicus adapts its metabolism based on growth conditions, with the same enzymes being employed for both degradative and synthetic pathways .

How does the enzymatic efficiency of recombinant S. aciditrophicus ATP synthase compare to native enzyme preparations?

ParameterNative PreparationRecombinant ExpressionNotes
Specific activity (μmol/min/mg)Variable (condition-dependent)Typically lower initiallyRecombinant protein may require optimization of folding conditions
Substrate affinity (Km for ATP)Lower (higher affinity)Often higher (lower affinity)Differences in post-translational modifications may affect binding
pH optimum6.8-7.2May shift 0.2-0.5 unitsExpression system influences protein properties
Temperature stabilityStable at 30-37°CVariable depending on expression systemAddition of stabilizing agents may be necessary for recombinant preparations
Inhibitor sensitivityBenchmark sensitivityMay show altered sensitivityStructural differences can impact inhibitor binding sites

When comparing native and recombinant enzyme preparations, researchers should systematically evaluate these parameters to ensure that recombinant proteins accurately reflect the properties of the native enzyme. Divergences may indicate issues with protein folding, post-translational modifications, or subunit assembly that need to be addressed through optimization of expression and purification conditions.

What is the relationship between ATP synthase activity and cellular energy status in different growth conditions?

Growth ConditionAMP:ATP RatioPyrophosphate LevelATP Synthase ActivityMetabolic Direction
Pure culture (crotonate)5.9 ± 1.4HighHigh acetyl-CoA synthetase activityPrimarily synthetic
Coculture (benzoate)VariableModerate to highHigh acetyl-CoA synthetase activityPrimarily degradative
Coculture (cyclohexane-1-carboxylate)VariableModerate to highHigh acetyl-CoA synthetase activityPrimarily degradative
Nutrient limitationElevatedTypically lowerReducedShifts based on available substrates

The high AMP-to-ATP ratio (5.9 ± 1.4) observed in S. aciditrophicus cells supports the operation of acetyl-CoA synthetase (Acs1) in the acetate-forming direction . This elevated ratio, combined with high pyrophosphate levels, creates thermodynamically favorable conditions for ATP synthesis via the novel pyrophosphate-dependent mechanism.

What are the most common issues encountered when attempting to express recombinant S. aciditrophicus ATP synthase subunits, and how can they be addressed?

Expressing recombinant ATP synthase subunits presents several challenges due to their membrane protein nature and complex assembly requirements. Common issues and solutions include:

  • Poor expression yields:

    • Optimize codon usage for expression host

    • Test multiple expression vectors with different promoter strengths

    • Explore lower expression temperatures (16-25°C)

    • Consider specialized E. coli strains designed for membrane proteins

  • Inclusion body formation:

    • Use solubility-enhancing fusion partners (MBP, SUMO, Trx)

    • Optimize induction conditions (lower IPTG concentration, longer expression time)

    • Develop effective refolding protocols if expression in inclusion bodies is unavoidable

    • Consider cell-free expression systems

  • Purification difficulties:

    • Screen multiple detergents for optimal solubilization

    • Implement two-step affinity purification to increase purity

    • Use size exclusion chromatography as a final polishing step

    • Consider native purification techniques to maintain subunit associations

  • Activity loss during purification:

    • Include stabilizing agents in all buffers (glycerol, specific lipids)

    • Minimize time between steps to reduce protein degradation

    • Maintain consistent cold temperature throughout the procedure

    • Consider reconstitution into liposomes to restore activity

How can researchers verify the functionality of recombinant S. aciditrophicus ATP synthase subunit b 1 after purification?

Verifying the functionality of recombinant ATP synthase subunit b 1 requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to evaluate secondary structure

    • Thermal shift assays to determine stability

    • Limited proteolysis to assess proper folding

    • Native gel electrophoresis to evaluate oligomeric state

  • Binding studies:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Surface plasmon resonance to measure interaction kinetics

    • Cross-linking studies to identify interaction partners

    • Fluorescence anisotropy to detect binding events

  • Functional assays:

    • Reconstitution with other subunits to restore ATP synthesis activity

    • Proton translocation measurements in reconstituted proteoliposomes

    • ATP hydrolysis measurements using colorimetric phosphate detection

    • Structural studies by electron microscopy to confirm proper assembly

What emerging technologies hold promise for advancing our understanding of S. aciditrophicus ATP synthase structure and function?

Several cutting-edge technologies are poised to revolutionize research on S. aciditrophicus ATP synthase:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution structural determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Solid-state NMR for membrane protein structural studies

    • Integrative structural biology combining multiple techniques

  • Systems biology approaches:

    • Genome-scale metabolic modeling to predict energetic requirements

    • Multi-omics integration for comprehensive pathway analysis

    • Single-cell analyses to detect population heterogeneity

    • Metabolic flux analysis using stable isotopes

  • Genetic manipulation technologies:

    • CRISPR-Cas9 systems adapted for anaerobic bacteria

    • Inducible gene expression systems for controlled studies

    • Site-specific mutagenesis for structure-function analyses

    • Heterologous expression systems for functional validation

These emerging technologies will enable researchers to address fundamental questions about the unique ATP synthesis mechanisms in S. aciditrophicus and their evolutionary significance.

What are the potential applications of understanding S. aciditrophicus ATP synthase beyond basic research?

The unique properties of S. aciditrophicus ATP synthase and its associated energy conservation mechanisms have potential applications in several fields:

  • Bioenergy production:

    • Development of more efficient anaerobic digestion processes

    • Enhanced biogas production through syntrophic partnerships

    • Novel biocatalysts for low-energy conversion processes

    • Optimization of microbial electrosynthesis systems

  • Biotechnology applications:

    • Engineering organisms with enhanced ATP production efficiency

    • Development of ATP regeneration systems for industrial biocatalysis

    • Creation of synthetic pyrophosphate-dependent metabolic pathways

    • Design of novel biocatalysts for specific chemical transformations

  • Environmental remediation:

    • Enhanced degradation of aromatic pollutants through syntrophic processes

    • Development of bioreactors with improved energy efficiency

    • Monitoring tools for anaerobic degradation processes

    • Engineered syntrophic consortia for specific remediation applications

Understanding the fundamental mechanisms of energy conservation in S. aciditrophicus provides insights that can be leveraged for various biotechnological applications while expanding our understanding of microbial adaptations to energy-limited environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.