Recombinant Syntrophus aciditrophicus ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock
Cat. No.
BT2433876
Source
in vitro E.coli expression system
Synonyms
atpE; SYNAS_07470; SYN_02965; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Quick Inquiry

Description

Background on Syntrophus aciditrophicus

Syntrophus aciditrophicus is a syntrophic bacterium that plays a key role in anaerobic environments by degrading organic compounds into simpler substances like acetate, carbon dioxide, formate, and hydrogen. These products are then utilized by methanogenic archaea to produce methane . The bacterium's ability to thrive in low-energy environments is partly due to its efficient energy conservation mechanisms, such as the use of pyrophosphate-dependent ATP formation from acetyl-CoA .

ATP Synthase and Subunit c

ATP synthase is an enzyme complex that utilizes the proton gradient across cell membranes to synthesize ATP from ADP and inorganic phosphate. Subunit c is a critical component of this complex, involved in the proton translocation process that drives ATP synthesis . While the general function of subunit c is well understood, specific details about the recombinant version from S. aciditrophicus are not readily available in the literature.

Data and Tables

Currently, there is no specific data or tables available for the recombinant Syntrophus aciditrophicus ATP synthase subunit c (atpE). The information on S. aciditrophicus generally focuses on its metabolic pathways and unique energy conservation mechanisms rather than detailed biochemical characteristics of specific recombinant proteins.

References

  1. PMC6488403: Syntrophus aciditrophicus uses reversible pathways for the degradation of organic compounds.

  2. mbio.03740-21: Enoyl-Coenzyme A respiration in syntrophic bacteria.

  3. PMC4992975: Pyrophosphate-dependent ATP formation in S. aciditrophicus.

  4. OSTI: Overview of S. aciditrophicus metabolism.

  5. PMC8942843: Acyl-proteome of S. aciditrophicus reveals metabolic insights.

  6. Frontiers in Bioengineering and Biotechnology: Engineering cytochrome P450 enzymes.

  7. PNAS: Subunit c in ATP synthase and its functional specificity.

  8. Creative Biomart: Recombinant proteins for research.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpE; SYNAS_07470; SYN_02965; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Syntrophus aciditrophicus (strain SB)
Target Names
atpE
Target Protein Sequence
MVTCLTTFAVLLLTAAVASAAEAAAPGGESYVKAIFAVGAMIGAGIAIGVGAVGAGLGIG TAASGACQAVGRNPGVQGKIMMTMLVGMAMAESIAIYALVVSLVLIFANPYTKFFFVG
Uniprot No.
Q2LRB9

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. A key F0 channel component, subunit c, directly participates in transmembrane translocation. A homomeric c-ring, consisting of 10-14 subunits, forms the central stalk rotor element along with the F1 delta and epsilon subunits.
Database Links

KEGG: sat:SYN_02965

STRING: 56780.SYN_02965

Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.