Recombinant Syntrophus aciditrophicus Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Overview of MsbA in Gram-Negative Bacteria

MsbA is an essential ATP-binding cassette (ABC) transporter responsible for lipid A and lipopolysaccharide (LPS) transport across the cytoplasmic membrane in Gram-negative bacteria . It functions as a homodimer, with each monomer containing a transmembrane domain (6 helices) and a nucleotide-binding domain (NBD) . MsbA facilitates ATP-dependent flipping of lipid A from the inner to outer leaflet of the membrane, a critical step for outer membrane biogenesis .

Key Features of MsbA:

FeatureDescriptionOrganisms Studied
StructureInward-facing conformation with a large transmembrane portal for substrate entry .Salmonella typhimurium
Substrate BindingTwo distinct sites: high-affinity lipid A binding and lower-affinity drug binding .Escherichia coli
ATPase ActivityBasal activity modulated by lipid A and amphipathic drugs; coupled adenylate kinase activity .E. coli, S. typhimurium
Recombinant ExpressionPurified from E. coli or Pseudomonas fluorescens with retained ATPase activity .Pseudomonas fluorescens

Substrate Transport Mechanism

  • Lipid A binds MsbA with a KdK_d of ~0.35–10 μM, while drugs like daunorubicin occupy a separate site .

  • Nucleotide binding (ATP/ADP) modulates lipid A affinity, suggesting bidirectional communication between NBDs and substrate-binding sites .

  • Structural studies reveal an intermediate inward-facing conformation in S. typhimurium MsbA, enabling lipid A entry into the transport pathway .

Enzymatic Activities

  • ATP Hydrolysis: MsbA hydrolyzes ATP to drive lipid flipping, with activity enhanced by lipid A and inhibited by detergents .

  • Adenylate Kinase (AK) Activity: Under ATP-depleted conditions, MsbA catalyzes ADP → ATP + AMP conversion, forming a cyclic ATPase-AK coupling mechanism .

Recombinant MsbA Production

While recombinant S. aciditrophicus MsbA is not explicitly documented, protocols for homologous systems (e.g., P. fluorescens) provide a template:

Expression and Purification (Example from P. fluorescens MsbA ):

ParameterDetail
Expression HostE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–601 aa)
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile water + 50% glycerol for long-term stability

Gaps in S. aciditrophicus MsbA Research

Available studies on S. aciditrophicus focus on its acyl-proteome and benzoate degradation pathways , with no direct mention of MsbA. Key findings in this syntroph include:

  • Post-Translational Modifications (PTMs): Heavy lysine acylation (e.g., 3-hydroxypimeloylation) linked to reactive acyl-CoA intermediates .

  • Metabolic Regulation: Functional deacylases suggest dynamic control of acylated enzymes in benzoate degradation .

Future Directions

  1. Heterologous Expression: Clone S. aciditrophicus msbA into E. coli or yeast systems, leveraging protocols from P. fluorescens .

  2. Functional Assays: Test ATPase activity, lipid A binding, and drug interactions using fluorescence quenching (e.g., MIANS labelling) .

  3. Structural Studies: Cryo-EM or X-ray crystallography to resolve substrate-binding sites and conformational changes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; SYNAS_22440; SYN_01564; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Syntrophus aciditrophicus (strain SB)
Target Names
msbA
Target Protein Sequence
MAGNRGCKPRRFEGNQRMDIFKRLLKLARPHAPRFAVAMVCMLIAGALTSSLAFLVKPAL DDIFLDRNAEMLKWIPLAIILIYLVKGGCSYFQAILMSFIGQRIVADLRNRLYEQIQKQS LSFFSKNPTGVLMSRITNDVNSIQGTVSDAVTSLMKDSFTLICLVFVIFYRDWQLAIIAM IVFPLTIYPIAKFGQKMRSVATRTQVTMGSLTTLLQETISGTRIVRAFCMEAHENQRFAR ENEKLMHLALKSVSINALSSPFMEFLGGIGIAAIIFYGGYQVIKGSSTPGTFFSFLTALI MLYEPVKRLTNVNNTIQQGIAGAQRVFSIIDLVPDIVDRDEAVELPRISEKIEIRNISFA YDDTPVLRNINLTIRAGEVVAFVGMSGGGKTTLVNLIPRFYDVTAGQILIDGHDIRDVSL ISLRRQIGIVTQQTILFNDTVRNNIAYGSQGCSEKEIIEAARAANAHDFIVNLPEGYDTV IGELGTKLSGGERQRISIARALLKNAPILILDEATSSLDTEAEMEVQEALERLMKGRTTL VIAHRLSTIRNADRIVVLVKGEIVEEGAHETLLARRGEYYKLHQLQFKEDKVGEEVGRND S
Uniprot No.

Target Background

Function
This protein plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.