Recombinant Syntrophus aciditrophicus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzyme Definition and Biochemical Properties

Undecaprenyl-diphosphatase (EC 3.6.1.27) is a membrane-bound hydrolase that participates in peptidoglycan biosynthesis by regenerating UP, essential for lipid II cycle turnover . In Syntrophus aciditrophicus, a syntrophic bacterium, uppP likely plays a conserved role in maintaining cell wall integrity, though its precise metabolic integration remains under investigation.

PropertyDescription
EC Number3.6.1.27
Catalyzed ReactionUndecaprenyl diphosphate+H2OUndecaprenyl phosphate+Phosphate\text{Undecaprenyl diphosphate} + \text{H}_2\text{O} \rightarrow \text{Undecaprenyl phosphate} + \text{Phosphate}
CofactorsDivalent cations (e.g., Ca²⁺) enhance activity
Structural Motifs(E/Q)XXXE and PGXSRSXXT motifs; periplasmic histidine residue

Enzyme Structure and Active Site

UppP is an integral membrane protein with a periplasmic active site. Structural modeling and mutagenesis studies in homologous systems (e.g., E. coli) reveal key functional residues:

  • Glutamate-rich motifs: (E/Q)XXXE sequences coordinate substrate binding and catalysis .

  • Histidine residue: Positioned in the periplasm, critical for dephosphorylation .

  • PGXSRSXXT motif: Stabilizes the transition state during phosphate release .

Residue/MotifRole in Catalysis
E/QXXXEBinds UPP diphosphate group, facilitates nucleophilic attack
PGXSRSXXTAnchors substrate, stabilizes transition state
HistidineProton transfer during phosphate hydrolysis

Catalytic Mechanism

UppP operates via a two-step mechanism:

  1. Substrate binding: UPP binds to the (E/Q)XXXE motif, positioning the diphosphate group for hydrolysis.

  2. Dephosphorylation: A water molecule attacks the diphosphate, releasing phosphate and regenerating UP. Divalent cations (e.g., Ca²⁺) stabilize the transition state .

This reaction ensures a continuous supply of UP for cell wall synthesis, particularly under stress conditions where antibiotic resistance (e.g., bacitracin) may be critical .

Role in Cellular Metabolism

While S. aciditrophicus primarily employs reversible ligases (e.g., SYN_RS03335) for aromatic acid metabolism , uppP likely supports general cell wall homeostasis. Its activity links to:

  • Peptidoglycan synthesis: UP is required for lipid II precursor transport across the membrane .

  • Antibiotic resistance: Inhibition of uppP by bacitracin disrupts UP recycling, leading to cell lysis .

In syntrophic communities, uppP may indirectly influence energy metabolism by maintaining membrane integrity during substrate exchange.

Key Studies

  • Mutagenesis Experiments:

    • E/QXXXE motif mutations (e.g., E→A) reduce activity by >90% .

    • Histidine deletion abolishes catalysis .

  • Structural Models:

    • Periplasmic localization of active site residues, validated via molecular dynamics .

    • Dimeric architecture suggested for membrane stability .

Comparative Analysis

FeatureS. aciditrophicus uppPE. coli uppP
Active Site MotifsConserved (E/Q)XXXE, PGXSRSXXT Similar motifs, with H residue
Cofactor DependenceCa²⁺ required Mg²⁺ or Ca²⁺ enhance activity
Antibiotic ResistanceLikely via UP recycling Confirmed bacitracin resistance

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; SYNAS_28830; SYN_02394; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Syntrophus aciditrophicus (strain SB)
Target Names
uppP
Target Protein Sequence
MKKHHLRHALLVLSAAILLAVSCSFSAASASASPPASEKKIAVWEAAILGVVEGITEYLP ISSTGHLILASHALGMTQFSETRGPLGTLMVKNDAMDSYNIVIQLGAILAVLGLYRKRVK QMLKGLSGALAVLVSRRSVTALGDSERQGLKLLGLLLLAFLPAAVFGKLFHEVIETYLFG PLPVVYALVAGGVLMIGVEYFFWLKDRNRLRISDVNSMFYRQALFIGMMQVVSMWPGTSR SMITMIAGLIVGLDMIAAAEFSFLLALPTLGAATLYSGYKNWHALDDSAGMLALAVGLAV SWLTAVIAVKALVRWLTHHGLIPFGVYRILLAGVLLIYFWQWR
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of undecaprenyl-diphosphatase (UppP) in bacterial cell wall biosynthesis?

Undecaprenyl-diphosphatase (UppP, EC 3.6.1.27) catalyzes the essential reaction converting undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP) in the bacterial lipid II cycle. This dephosphorylation reaction is crucial for recycling the lipid carrier molecule that shuttles peptidoglycan precursors from the cytoplasm to the exterior of the cell membrane for incorporation into the growing cell wall . The reaction can be represented as:

Undecaprenyl diphosphate + H₂O → Undecaprenyl phosphate + Phosphate

This reaction is particularly vital because the cellular pool of lipid carriers is limited, and efficient recycling is necessary for maintaining adequate cell wall synthesis rates. In Bacillus subtilis, UppP functions alongside BcrC (another UPP phosphatase) to maintain cell envelope integrity, with these enzymes constituting a synthetic lethal gene pair - meaning that bacteria cannot survive if both are inactivated simultaneously . The essential nature of UPP phosphatase activity underscores the potential of these enzymes as antibiotic targets.

  • How does UppP contribute to bacterial resistance to the antibiotic bacitracin?

UppP plays a significant role in bacterial resistance to bacitracin, a peptide antibiotic that specifically binds to UPP and prevents its dephosphorylation, thereby inhibiting cell wall synthesis . By catalyzing the conversion of UPP to UP, UppP effectively reduces the concentration of UPP available for bacitracin binding. This competition for substrate represents a key resistance mechanism.

Although BcrC appears to be the primary UPP phosphatase contributing to bacitracin resistance in B. subtilis, the relative contributions of different UPP phosphatases to antibiotic resistance may vary across bacterial species. In S. aciditrophicus, understanding UppP's specific role in antimicrobial resistance would require directed studies on this organism's response to cell envelope targeting antibiotics.

  • What are the key structural features that enable UppP's enzymatic activity?

UppP's enzymatic activity depends on several critical structural features:

Structural FeatureFunctionConservation
Transmembrane domainsAnchor in cytoplasmic membrane and position active siteHighly conserved topology
Catalytic siteContains residues for phosphate hydrolysisConserved acidic and basic residues
Metal binding siteCoordinates divalent cations (e.g., Ca²⁺)Conserved metal-binding motifs
Substrate binding pocketAccommodates undecaprenyl chainHydrophobic residues
Membrane interfaceAllows access to membrane-embedded substrateVariable architecture

As a membrane protein, UppP typically contains multiple transmembrane helices that position its active site to access the membrane-embedded UPP substrate . The enzyme's activity is enhanced by divalent cations, particularly Ca²⁺, suggesting the presence of a metal-binding site that facilitates coordination of water for nucleophilic attack on the phosphate bond .

The catalytic mechanism likely involves conserved acidic residues for metal coordination, basic residues for interaction with phosphate groups, and hydrophobic residues forming a pocket to accommodate the undecaprenyl tail. In bacteria like B. subtilis, UppP works alongside other UPP phosphatases such as BcrC, suggesting some structural or functional specialization among these enzymes .

  • What experimental methods are used to measure UppP enzymatic activity?

Researchers employ several methodological approaches to measure UppP enzymatic activity:

  • Colorimetric phosphate release assay:

    • Reaction mixture contains purified UppP and UPP substrate

    • Released inorganic phosphate is detected using molybdate-based reagents

    • Absorbance is measured at 620-660 nm

    • Quantification against a phosphate standard curve

  • Radiolabeled substrate approach:

    • [³²P]-labeled UPP is used as substrate

    • Products are separated by thin-layer chromatography

    • Quantification by autoradiography or scintillation counting

  • HPLC or LC-MS based methods:

    • Reaction products (UP and phosphate) are separated and quantified

    • Provides direct measurement of both substrate consumption and product formation

  • Indirect measurements in vivo:

    • Cell wall stress response reporters can be used to monitor UppP activity

    • In B. subtilis, the σᴹ-dependent PyuaF promoter activity serves as an indirect measure of UPP phosphatase function

When designing activity assays for UppP, researchers must carefully control for:

  • pH (typically 7.0-8.0)

  • Temperature (30-37°C)

  • Divalent cation concentration (Ca²⁺ or Mg²⁺, 1-10 mM)

  • Detergent type and concentration (for purified protein assays)

For recombinant S. aciditrophicus UppP, assay conditions may need to be optimized for the specific biochemical properties of this enzyme, potentially including consideration of the anaerobic environment of this organism.

  • How is UppP regulated in response to cell envelope stress?

UppP regulation under cell envelope stress conditions varies across bacterial species, with important implications for stress adaptation and antibiotic resistance:

In B. subtilis, studies have revealed distinct regulatory patterns for UppP compared to other UPP phosphatases like BcrC. While bcrC expression is upregulated in response to cell envelope stress caused by antibiotics like bacitracin, uppP expression remains relatively constant . This differential regulation suggests specialized roles for these enzymes despite their overlapping functions.

The regulation mechanisms involve:

  • Stress-responsive sigma factors:

    • In B. subtilis, the alternative sigma factor σᴹ controls expression of genes involved in cell envelope stress response

    • The bcrC gene is part of the σᴹ regulon, whereas uppP appears to be constitutively expressed

  • Two-component systems:

    • Systems like BceRS in B. subtilis sense cell envelope stress

    • Trigger expression of resistance determinants

    • May indirectly affect UppP function through modulation of cell envelope composition

  • Feedback mechanisms:

    • UPP phosphatase activity is linked to cell envelope homeostasis

    • Limited UPP phosphatase activity triggers cell envelope stress responses

    • This homeostatic feedback renders BcrC more important during growth than UppP in B. subtilis

Advanced Research Questions

  • What are the mechanistic differences between UppP from S. aciditrophicus and other bacterial species?

Mechanistic differences between UppP from S. aciditrophicus and other bacterial species like B. subtilis reflect their evolutionary divergence and adaptation to different environmental niches:

Catalytic mechanism: While the core function—dephosphorylation of UPP to UP—is conserved, sequence analysis suggests potential differences in:

FeatureS. aciditrophicus UppPOther bacterial UppP (e.g., B. subtilis)Functional Implication
Metal coordinationPotentially different acidic residue arrangementConserved metal-binding motifsMay affect metal preference and catalytic efficiency
Active site architectureAdaptation to acidic environmentOptimized for neutral pHDifferent pH optima for enzymatic activity
Membrane integrationAdapted to S. aciditrophicus membrane compositionSpecies-specific membrane adaptationDifferential activity in varied lipid environments

Physiological roles: In B. subtilis, UppP plays a prominent role in sporulation, while BcrC is more important during vegetative growth and in defense against cell envelope stress . S. aciditrophicus, as a non-sporulating anaerobic syntrophic bacterium, likely employs UppP differently in its cellular physiology.

Regulatory networks: The expression of uppP in B. subtilis does not increase in response to cell envelope stress conditions caused by antibiotics like bacitracin, unlike bcrC . The regulatory mechanisms controlling S. aciditrophicus UppP expression may differ significantly due to its distinct lifestyle and environmental challenges.

To investigate these differences experimentally, approaches would include:

  • Comparative biochemical characterization of recombinant enzymes

  • Site-directed mutagenesis of predicted catalytic residues

  • Heterologous expression studies in different host backgrounds

  • Structural studies comparing enzyme conformations and substrate binding modes

These mechanistic differences may provide insights into bacterial adaptation and could potentially be exploited for species-specific enzyme inhibition strategies.

  • How do mutations in the uppP gene affect bacterial cell wall integrity and antibiotic resistance?

Mutations in the uppP gene can significantly impact bacterial cell wall integrity and antibiotic resistance through several mechanisms:

Cell wall integrity effects:

  • Complete loss of UppP function can be lethal in bacteria lacking compensatory UPP phosphatases, as demonstrated in B. subtilis where uppP and bcrC constitute a synthetic lethal gene pair

  • Partial loss-of-function mutations may lead to altered cell morphology, compromised cell wall thickness, or growth defects

  • In B. subtilis with limited UPP phosphatase levels, cell growth and morphology are severely impaired during exponential growth

Antibiotic resistance implications:

Different types of mutations can have varying effects:

Mutation TypePhenotypic EffectMechanism
Null mutationsPotentially lethal if no compensatory phosphatasesComplete loss of essential enzymatic activity
Partial loss-of-functionIncreased antibiotic sensitivity, altered morphologyReduced UPP dephosphorylation capacity
Regulatory mutationsAltered expression patternsInability to adjust UppP levels in response to stress
Gain-of-functionPotential increased resistance to bacitracinEnhanced UPP dephosphorylation bypassing inhibition

Research approaches to study these effects include:

  • Creation of defined point mutations in conserved catalytic residues

  • Determination of MICs for various cell wall-targeting antibiotics

  • Microscopic analysis of cell morphology and division patterns

  • Cell wall composition analysis by HPLC or mass spectrometry

  • In vivo activity measurements using cell envelope stress reporters

For S. aciditrophicus specifically, uppP mutations might have unique consequences due to the bacterium's distinct cell envelope composition and metabolic requirements as an anaerobic syntrophic organism.

  • What are the current challenges in expressing and purifying functional recombinant S. aciditrophicus UppP?

The expression and purification of functional recombinant S. aciditrophicus UppP presents several significant challenges:

Membrane protein expression barriers:

  • Toxicity to host cells due to membrane protein overexpression

  • Improper folding leading to inclusion body formation

  • Low expression yields common with membrane proteins

  • Difficulty in solubilizing without disrupting structure and function

S. aciditrophicus-specific challenges:

  • Adaptation to anaerobic lifestyle may affect protein stability in aerobic expression systems

  • Codon usage bias between S. aciditrophicus and common expression hosts

  • Potential requirement for specific lipid environments for proper folding and function

Purification challenges:

  • Selection of appropriate detergents that maintain enzymatic activity

  • Limited stability in solubilized form

  • Activity loss during purification steps

  • Aggregation during concentration procedures

Methodological approaches to overcome these challenges:

ChallengeStrategyImplementation Details
Toxicity to host cellsInducible tight expression systemsUse of pBAD or Tet-inducible systems with fine-tuned expression
Improper foldingLower temperature expressionInduction at 16°C for 18-24 hours
Low expression yieldsFusion tagsMBP, SUMO, or other solubility-enhancing fusion partners
Detergent selectionDetergent screeningSystematic testing of mild detergents (DDM, LMNG, etc.)
Activity preservationLipid supplementationAddition of specific lipids during purification
Stability issuesNanodiscs or liposome reconstitutionIncorporation into more native-like membrane environments

Functional validation of the purified protein presents additional challenges, as activity assays need to be adapted for detergent-solubilized membrane proteins. Researchers often employ phosphate release assays with synthetic substrates or reconstitute the protein into liposomes for more physiologically relevant activity measurements.

Successfully overcoming these challenges requires an integrated approach combining molecular biology techniques with protein biochemistry expertise and careful optimization of each step from gene design to final activity assays.

  • How does the enzymatic activity of UppP respond to different divalent cations, particularly Ca²⁺?

The enzymatic activity of UppP is significantly influenced by divalent cations, with Ca²⁺ often showing the most pronounced effect . This cation dependence reflects the catalytic mechanism and can vary between UppP homologs from different bacterial species.

Divalent cations play several key roles in UppP function:

  • They coordinate with the phosphate groups of the substrate

  • They facilitate positioning of a water molecule for nucleophilic attack

  • They stabilize the negative charge in the transition state

  • They may induce conformational changes that optimize active site geometry

The typical relative activity pattern with different cations follows:

Divalent CationRelative ActivityOptimal Concentration Range
Ca²⁺100% (highest)5-10 mM
Mg²⁺60-80%5-10 mM
Mn²⁺40-70%1-5 mM
Zn²⁺20-40%0.1-1 mM (inhibitory at higher concentrations)
Co²⁺10-30%1-5 mM

Metal ion effects on kinetic parameters typically include:

  • Decreased Km (increased substrate affinity)

  • Increased kcat (enhanced catalytic rate)

  • Concentration-dependent effects on Vmax

Experimental approaches to study these effects include:

  • Activity assays with varied cation types and concentrations

  • Isothermal titration calorimetry to measure binding affinities

  • Circular dichroism to detect conformational changes upon cation binding

  • Site-directed mutagenesis of predicted metal-coordinating residues

For S. aciditrophicus UppP specifically, the cation preferences might reflect adaptations to its unique ecological niche as an acidophilic, syntrophic bacterium. The intracellular concentration and availability of different divalent cations in S. aciditrophicus under various growth conditions would provide valuable context for understanding the physiological relevance of these effects.

  • What computational approaches can be used to predict substrate binding sites in S. aciditrophicus UppP?

Computational approaches offer powerful tools for predicting substrate binding sites in S. aciditrophicus UppP, especially when experimental structural data is limited:

Structure prediction and analysis:

  • Homology modeling based on known UppP structures

  • Threading approaches using programs like I-TASSER or AlphaFold

  • Model refinement focusing on transmembrane regions and potential active sites

  • Molecular dynamics simulations in explicit membrane environments

Molecular docking studies:

  • Preparation of UPP substrate with appropriate charge states

  • Blind docking to identify potential binding sites

  • Focused docking in predicted binding regions

  • Analysis of binding energy contributions and key interactions

Sequence-based approaches:

MethodImplementationOutput
Conservation analysisConSurf, Rate4SiteIdentification of functionally important residues
Correlated mutation analysisGREMLIN, EVfoldCo-evolving residue pairs that may form substrate contacts
Binding site predictionDeepSite, P2RankPrediction of binding pockets from protein structure
Sequence motif analysisMEME, GLAM2Identification of conserved motifs associated with substrate binding

Simulation approaches:

  • Long-timescale molecular dynamics (>100 ns) to identify stable binding conformations

  • Free energy calculations to estimate binding affinities

  • Steered molecular dynamics to study substrate entry/exit pathways

  • QM/MM approaches to model the reaction mechanism including metal ion coordination

For S. aciditrophicus UppP specifically:

  • Incorporate membrane composition parameters relevant to this organism

  • Account for pH conditions relevant to its acidophilic nature

  • Compare predictions with experimentally verified residues from homologous proteins

The most effective approach would combine multiple computational methods with targeted experimental validation through site-directed mutagenesis and activity assays, creating an iterative cycle of prediction and validation to build a comprehensive understanding of substrate binding and catalysis.

  • How can isotope labeling techniques be applied to track UppP activity in vivo?

Isotope labeling techniques provide powerful tools for tracking UppP activity in vivo, offering insights into the dynamics of undecaprenyl phosphate metabolism under physiological conditions:

Radioactive isotope approaches:

  • ³²P-labeled precursor feeding:

    • Supply bacteria with ³²P-orthophosphate

    • Extract membrane lipids at different time points

    • Separate UP and UPP by thin-layer chromatography

    • Quantify radioactivity in each fraction

    • Compare patterns between wild-type and uppP mutant strains

  • ¹⁴C-labeled isoprenoid precursors:

    • Feed cells with [¹⁴C]-isopentenyl pyrophosphate

    • Track incorporation into undecaprenyl-containing molecules

    • Analyze turnover rates in different genetic backgrounds

Stable isotope methodologies:

Isotope Labeling ApproachMethodologyAnalytical TechniqueInformation Obtained
¹³C-labeled precursorsGrow bacteria with ¹³C-glucoseLC-MS/MSFlux through UPP/UP cycling
¹⁸O-water incorporationIncubate in H₂¹⁸O-containing mediumMass spectrometryDirect measurement of phosphatase activity
²H-labeled lipidsDeuterated substrate supplementationNMR or MS analysisMembrane incorporation dynamics
¹⁵N-labeled peptidoglycan¹⁵N-amino acid feedingSolid-state NMRCell wall synthesis rates

Advanced monitoring approaches:

  • Pulse-chase experiments to determine turnover rates and pool sizes

  • Kinetic isotope effect studies to elucidate rate-limiting steps

  • Correlation of isotope incorporation with phenotypic indicators of cell wall stress

Implementation challenges for S. aciditrophicus:

  • Anaerobic growth requirements necessitating specialized equipment

  • Potentially slower growth and metabolism affecting labeling patterns

  • Need for co-culture systems with syntrophic partners

  • Optimization of extraction protocols for S. aciditrophicus membrane lipids

These isotope labeling approaches provide quantitative insights into UppP activity within its cellular context, offering a more physiologically relevant understanding than isolated in vitro studies and allowing researchers to track the impact of environmental conditions or genetic modifications on undecaprenyl phosphate metabolism.

  • What is the relationship between UppP activity and de novo synthesis of undecaprenyl phosphate?

The relationship between UppP-mediated recycling and de novo synthesis of undecaprenyl phosphate represents a critical aspect of bacterial cell wall homeostasis:

Primary sources of undecaprenyl phosphate (UP):

  • Recycling pathway: UppP dephosphorylates UPP released after peptidoglycan precursor incorporation into the cell wall

  • De novo synthesis: UPP synthetase (UppS) catalyzes sequential condensation of isopentenyl pyrophosphate with farnesyl pyrophosphate to generate UPP, which is then dephosphorylated to UP

  • Minor pathways: Phosphorylation of undecaprenol by kinases like DgkA can also contribute to the UP pool

The balance between these pathways affects:

  • Cell wall synthesis rate and efficiency

  • Response to cell envelope stress

  • Antibiotic resistance

  • Energy economy of the cell

Experimental evidence indicates these pathways are interconnected:

Regulatory coordination:
The cell must balance recycling and de novo synthesis based on growth conditions and stress factors. The molecular mechanisms coordinating these processes remain incompletely understood, but likely involve:

  • Sensing of UP/UPP ratios

  • Modulation of enzyme expression levels

  • Post-translational regulation of enzyme activities

For S. aciditrophicus specifically, studying this relationship would require investigating:

  • Expression patterns of uppP, uppS, and potential undecaprenol kinases

  • Metabolic fluxes under different growth conditions

  • Relative contributions of each pathway to the cellular UP pool

  • Energy constraints unique to this syntrophic organism's lifestyle

This relationship represents an important area for future research, as understanding the stoichiometry between recycling and de novo synthesis could reveal new targets for antibiotic development.

  • How does UppP function differ in anaerobic versus aerobic bacterial species?

The function of UppP in anaerobic bacteria like Syntrophus aciditrophicus likely differs from its counterparts in aerobic species in several important aspects:

Membrane environment adaptations:

  • Anaerobic bacteria often have distinct membrane compositions with different lipid species and fatty acid profiles

  • These membrane differences may affect UppP's physical environment, substrate accessibility, and catalytic efficiency

  • S. aciditrophicus may have evolved specific adaptations in UppP structure to function optimally in its membrane environment

Metabolic integration:

  • Anaerobic energy metabolism generates different intermediate metabolites and redox conditions

  • UppP function may be integrated with these distinct metabolic networks

  • The balance between UP recycling and de novo synthesis may differ based on energy availability in anaerobic metabolism

Regulatory mechanisms:

AspectAnaerobic Species (e.g., S. aciditrophicus)Aerobic Species (e.g., B. subtilis)Potential Impact
Redox sensitivityPotential adaptation to low-redox environmentAdaptation to oxidative conditionsDifferent structural features and activity regulation
Stress responseIntegration with anaerobic stress responsesWell-characterized aerobic stress responsesDistinct regulatory networks
Growth phase dependencyAdapted to slower growth ratesOptimized for rapid growthDifferent kinetic properties

Experimental approaches to investigate these differences:

  • Comparative biochemical characterization of recombinant UppP from anaerobic and aerobic species

  • Analysis of enzyme performance under aerobic vs. anaerobic conditions

  • Examination of UppP sequence conservation patterns across aerobic and anaerobic lineages

  • Investigation of syntrophic interactions affecting UppP function in S. aciditrophicus

The unique lifestyle of S. aciditrophicus as an anaerobic, syntrophic, acidophilic bacterium suggests its UppP may have distinct properties compared to well-studied aerobic models. These differences could include altered pH optima, different metal preferences, or unique regulatory mechanisms adapted to its ecological niche and metabolic lifestyle.

Understanding these differences could provide valuable insights into bacterial adaptation to different environmental conditions and might reveal novel aspects of cell wall biosynthesis regulation specific to anaerobic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.