Recombinant Tacaribe virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Tacaribe Virus Pre-glycoprotein Polyprotein GP Complex (GPC)

The Tacaribe virus (TCRV) is a New World mammarenavirus that serves as a prototype for its group . Unlike other New World mammarenaviruses, TCRV is not known to cause disease in humans and has demonstrated the ability to protect against the Junín virus (JUNV), which can cause Argentine hemorrhagic fever . Because of this, TCRV has potential as a live-attenuated vaccine .

The glycoprotein complex (GPC) of arenaviruses is unique because it keeps its signal peptide as part of the complex when it's infectious and on the virion . Most enveloped viruses have glycoproteins that bind to a host receptor to allow fusion with the host membrane, releasing the viral genome into the cytoplasm . In arenaviruses, GP1 facilitates the binding, while GP2 facilitates the fusion .

Development and Applications of Recombinant TCRV GPC

Reverse genetics systems have been developed to manipulate the TCRV genome, which has helped in creating recombinant TCRV (rTCRV) . These systems rely on the synthesis of full-length S and L antigenomic RNAs from T7 polymerase-driven plasmids, allowing for the rescue of infectious rTCRV with similar features to authentic TCRV .

  • Reverse Genetic System A reverse genetic system was developed that relies on T7 polymerase-driven intracellular expression of the complementary copy (antigenome) of both viral S and L RNA segments . This system successfully recovered rTCRV with growth properties resembling those of authentic TCRV .

  • Chimeric Virus Generation The reverse genetic approach was used to generate a chimeric rTCRV expressing GP from JUNV, which propagated at similar levels to wild-type rTCRV . This demonstrates the potential of the TCRV reverse genetic system as a platform for generating chimeric viruses expressing GP from different New World and Old World pathogenic mammarenaviruses, potentially applicable to vaccine development .

  • Attenuation Markers Modifications within the S RNA 5′ non-coding terminal sequence diminished rTCRV propagation in a cell-type-dependent manner, providing new perspectives for incorporating additional attenuation markers to develop safe rTCRV-based vaccines against pathogenic mammarenaviruses .

Role of Glucosylceramide in Glycoprotein-Mediated Membrane Fusion

Glucosylceramide (GlcCer) has been found to play a vital role in glycoprotein-mediated membrane fusion in certain tick-borne viruses .

  • HRTV and DBV Infection GlcCer is essential for Heartland virus (HRTV) and Dabie bandavirus (DBV) glycoprotein-induced membrane fusion . The infectivity of HRTV and DBV in glycosphingolipid biosynthesis-deficient cells was drastically reduced .

  • Mechanism of Action GlcCer targets the lipid-head-group binding pocket of HRTV glycoprotein in the host lysosomal membrane to form a stable lipid-protein complex, facilitating viral fusion and entry .

Impact of 5' Noncoding Region on Viral RNA Synthesis

The 5′ viral RNA noncoding region assists the L polymerase for efficient viral S RNA synthesis .

  • TV_P Mutation The TV_P mutation of the S genomic 5′ iNCR had little impact on viral virulence in mice . Decreased levels of S RNA synthesis during in vivo infection with mutant rTCRVsNCR may be insufficient to result in reduced viral yields .

  • S vRNA Accumulation A higher proportion of S vRNA over L vRNA accumulates both in purified virions and in mammarenavirus-infected cells during acute and persistent infections .

Cross-Reactivity of Neutralizing Antibodies

Differences in glycoprotein complex receptor binding site accessibility affect the cross-reactivity of neutralizing antibodies between closely related arenaviruses .

  • Chimeric GPC Structures Chimeric GPC structures were constructed in which the SSP, GP1, or GP2 segments of JUNV GPC were mix-matched with those of Machupo virus (MACV) .

  • Transduction Efficiency All M/J chimeras were capable of producing transduction-competent virus, albeit to widely varying capacities, with those virions bearing the GP2 from JUNV having markedly lower transduction levels than those bearing the MACV GP2 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
250-482
Protein Length
Full Length of Mature Protein
Species
Tacaribe virus (strain V7) (TCRV)
Target Names
GPC
Target Protein Sequence
AFFSWSLTDPLGNEAPGGYCLEKWMLVASELKCFGTLQCQVQPKSRLRVCDMLRLFDYNK NAIKTLNEETKTRVNVLSHTINALISDNLLMKNKIRELMSVPYCNYTRFWYVNHTLSGQH SLPRCWMIRNNSYLNSSEFRNEWILESDFLISEMLSKEYSERQGRTPITLVDICFWSTEF FISTLFLHLIGFPTHEHIRGEGCPLPHRLNSMGGCRCGKYLPLKKPTIWHRRH
Uniprot No.

Target Background

Function
The Tacaribe virus pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein. It mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. This fusion is driven by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide while also remaining a component of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational maturation (GP1 and GP2 cleavage), glycoprotein transport to the cell membrane, infectious virion formation, and acid pH-dependent cell fusion mediated by the glycoprotein. GPC also interacts with the host receptor.
Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is Tacaribe virus and how does it relate to pathogenic arenaviruses?

Tacaribe virus (TCRV) is the prototype member of the New World group of mammarenaviruses. It is naturally attenuated and does not cause severe disease in humans, but is phylogenetically and antigenically related to pathogenic South American mammarenaviruses, particularly Junín virus (JUNV), which causes Argentine hemorrhagic fever (AHF) . While most New World mammarenaviruses are maintained in rodent reservoirs, TCRV has been isolated from fruit bats (Artibeus), mosquitoes, and more recently from Amblyomma americanum ticks in Florida .

TCRV's importance in research stems from its close relationship to pathogenic arenaviruses combined with its attenuated nature, making it an excellent model organism and potential vaccine platform. Studies have shown that TCRV can protect guinea pigs and non-human primates from lethal challenges with pathogenic strains of JUNV, positioning it as a potential live-attenuated vaccine candidate .

What is the structure and function of the Tacaribe virus glycoprotein complex?

The Tacaribe virus glycoprotein complex originates from a glycoprotein precursor (GPC) that undergoes post-translational processing to form the mature envelope glycoproteins. The GPC is encoded on the small (S) genomic RNA segment, which also encodes the viral nucleoprotein (NP) . The GPC gene represents a critical component of TCRV, as it encodes proteins involved in host cell invasion .

Structurally, the TCRV GPC contains multiple domains with distinct functions in the viral life cycle. The processed GPC yields surface glycoproteins that mediate receptor binding and membrane fusion during viral entry. Research with neutralization-resistant variants has revealed that the epitopes recognized by neutralizing antibodies likely involve residues that are juxtaposed by conformation rather than by proximity in the linear sequence, suggesting a complex tertiary structure .

How does GPC processing occur in Tacaribe virus?

Processing of the Tacaribe virus GPC involves several post-translational modifications including signal peptide cleavage, glycosylation, and proteolytic processing. The GPC is initially synthesized as a precursor polyprotein that undergoes cleavage to generate the mature glycoproteins displayed on the viral surface.

Studies of TCRV GPC processing have revealed that the 3' half of the GPC gene likely codes for the envelope glycoprotein recognized by neutralizing antibodies . The processing pathway involves cellular proteases that cleave the precursor at specific sites, generating the mature glycoproteins that facilitate viral entry into host cells.

The importance of proper GPC processing is highlighted by research on neutralization-resistant variants, where amino acid substitutions affecting glycoprotein structure can alter recognition by neutralizing antibodies without necessarily compromising viral fitness .

What reverse genetic systems have been developed for Tacaribe virus?

Multiple reverse genetic systems have been developed for Tacaribe virus, allowing researchers to generate recombinant TCRV (rTCRV) with defined genetic modifications. These systems represent significant advances for studying TCRV biology and developing vaccine candidates.

One established system relies on T7 polymerase-driven intracellular expression of the complementary copy (antigenome) of both viral S and L RNA segments . This approach successfully generates rTCRV that displays growth properties resembling those of authentic TCRV. The system utilizes plasmids expressing the full-length antigenomic RNA under control of a T7 promoter .

Another system, described more recently, has demonstrated the feasibility of generating various recombinant TCRVs, including:

  • Wild-type recombinant TCRV

  • Trisegmented rTCRV expressing reporter genes

  • Bisegmented rTCRV expressing GFP

Researchers have also identified a 39-nucleotide deletion in the TCRV L-IGR that affects gene expression patterns, providing insights into viral regulatory mechanisms and potential attenuation strategies .

Reverse Genetic SystemKey FeaturesApplications
T7 polymerase-driven systemRelies on antigenomic expressionGeneration of rTCRV, chimeric viruses
Pol I-directed plasmid systemAlternative approachrTCRV rescue with phenotypical features resembling authentic TCRV
Reporter-expressing systemsIncorporation of reporter genesVisualization of viral infection, high-throughput screening

How can chimeric Tacaribe viruses expressing heterologous glycoproteins be created?

Generation of chimeric Tacaribe viruses expressing glycoproteins from other arenaviruses represents a valuable approach for vaccine development. The established reverse genetic systems for TCRV enable this strategy through targeted gene replacement.

A methodological approach for creating such chimeras involves:

  • Construction of a suitable plasmid vector containing the TCRV S segment with restriction sites flanking the GPC coding sequence

  • Replacement of the TCRV GPC gene with the heterologous GPC sequence (e.g., from JUNV)

  • Co-transfection of cells with the chimeric S segment plasmid alongside plasmids encoding the TCRV L segment

  • Recovery and amplification of the resulting chimeric virus

This approach has been successfully implemented to generate a chimeric rTCRV expressing JUNV glycoproteins (rTCRV GPXJcl3). Notably, this chimeric virus propagates at similar or even higher levels than wild-type rTCRV, demonstrating the feasibility of this platform .

Expression of heterologous glycoproteins in the chimeric virus can be verified through immunofluorescence analysis using antibodies specific for the heterologous glycoprotein. For instance, the JUNV GP1 in rTCRV GPXJcl3 was detected using an anti-JUNV GP1 specific monoclonal antibody (BF-11) that does not cross-react with TCRV GP .

What mutations in Tacaribe virus GPC affect neutralization susceptibility?

Studies on neutralization-resistant variants of Tacaribe virus have provided insights into the structural determinants of antibody recognition. These variants, generated through selection in the presence of neutralizing monoclonal antibodies (MAbs), exhibit specific mutations that confer resistance.

Analysis of neutralization-resistant TCRV variants has revealed:

  • Multiple nucleotide changes in the 3' half of the GPC gene, suggesting this region encodes the envelope glycoprotein recognized by neutralizing antibodies

  • Unique amino acid substitutions in resistant variants that can be as far as 166 residues apart in the linear sequence

  • Evidence that neutralization epitopes involve residues that are juxtaposed by protein folding rather than by proximity in the primary sequence

These findings highlight the conformational nature of neutralizing epitopes in TCRV GPC and provide important considerations for vaccine design and antibody-based therapeutics.

What methods are used to express and purify recombinant Tacaribe virus GPC?

Expression and purification of recombinant TCRV GPC require careful consideration of expression systems, purification strategies, and preservation of native conformation. Several methodological approaches have been employed:

Expression Systems:

  • Mammalian cell expression: Typically provides proper post-translational modifications and folding

    • HEK293T cells transfected with plasmids encoding GPC under CMV promoter

    • Stable cell lines expressing GPC for continuous production

  • Insect cell/baculovirus expression: Offers high yield with appropriate glycosylation

    • Sf9 or High Five cells infected with recombinant baculovirus carrying the GPC gene

  • Cell-free expression systems: For specific structural studies

    • Allows incorporation of modified amino acids for structural analysis

Purification Strategies:

  • Affinity chromatography using tagged constructs (His, FLAG, Strep-tag)

  • Size exclusion chromatography to separate aggregates and obtain homogeneous preparations

  • Ion exchange chromatography for further purification

The choice of detergents and stabilizing agents is critical when working with membrane proteins like GPC. Commonly used detergents include n-dodecyl β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin.

How can researchers design experiments to study GPC-mediated viral entry?

Studying GPC-mediated viral entry involves multiple experimental approaches that assess different stages of the entry process:

1. Receptor Binding Assays:

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Flow cytometry using fluorescently labeled virus or soluble GPC

  • Co-immunoprecipitation of GPC with putative receptor proteins

2. Membrane Fusion Assays:

  • Cell-cell fusion assays using GPC-expressing cells and receptor-expressing target cells

  • Fluorescent dye transfer assays to monitor content mixing during fusion

  • Syncytia formation observation under various pH conditions to assess fusion triggering

3. Entry Inhibition Studies:

  • Small molecule screening to identify entry inhibitors

  • Peptide inhibitors derived from fusion-active regions

  • Neutralizing antibody characterization

4. Live Imaging of Viral Entry:

  • Single-particle tracking of fluorescently labeled virions

  • Time-lapse confocal microscopy to follow internalization and membrane fusion

  • Super-resolution microscopy for detailed visualization of entry steps

When designing these experiments, researchers should consider using appropriate controls, including:

  • GPC mutants with known defects in specific entry steps

  • Heterologous GPCs from related viruses for comparative analysis

  • Inhibitors with established mechanisms of action as positive controls

What techniques are used to analyze the immunogenicity of recombinant Tacaribe virus GPC?

Analyzing the immunogenicity of recombinant TCRV GPC involves a multifaceted approach to characterize both humoral and cellular immune responses:

Humoral Immunity Assessment:

  • ELISA assays to quantify GPC-specific antibody titers

  • Virus neutralization tests to measure functional antibody responses

  • Epitope mapping using peptide arrays or competition assays

  • Avidity measurements to assess antibody maturation

Cellular Immunity Assessment:

  • ELISpot assays to enumerate GPC-specific T cells

  • Intracellular cytokine staining to characterize T cell functionality

  • Proliferation assays to measure antigen-specific T cell expansion

  • Cytotoxicity assays to evaluate CD8+ T cell killing of GPC-expressing targets

In Vivo Immunogenicity Models:

  • Small animal models (mice, guinea pigs) for initial immunogenicity assessment

  • Non-human primate studies for translational immunogenicity data

  • Challenge studies with homologous or heterologous viruses to assess protection

Data from these analyses should be comprehensively reported, including statistical comparisons between different vaccine formulations or administration routes.

How can recombinant Tacaribe virus be developed as a vaccine platform?

Recombinant Tacaribe virus offers significant potential as a vaccine platform, particularly for protection against pathogenic arenaviruses. The development pathway involves several key considerations:

Advantages of TCRV as a Vaccine Platform:

  • Natural attenuation in humans while maintaining immunogenicity

  • Phylogenetic and antigenic relationship to pathogenic South American arenaviruses

  • Demonstrated protection against JUNV challenge in animal models

  • Established reverse genetic systems enabling rational design

Development Strategies:

  • Live-attenuated TCRV vaccines: Using the wild-type virus with additional attenuation markers

  • Chimeric TCRV expressing heterologous glycoproteins: For targeted protection against specific pathogenic arenaviruses

  • TCRV-vectored vaccines: Expressing immunogens from non-arenavirus pathogens

Research has demonstrated that chimeric rTCRV expressing JUNV glycoproteins can be successfully generated and propagates efficiently in cell culture . This approach could potentially be extended to create multivalent vaccines expressing glycoproteins from multiple pathogenic arenaviruses.

Attenuation Approaches:

  • Introduction of specific mutations in non-coding regions (e.g., the 39-nucleotide deletion in L-IGR)

  • Codon deoptimization of viral genes

  • Modification of viral interferon antagonists

What are the comparative aspects of Tacaribe virus GPC versus glycoproteins from pathogenic arenaviruses?

Understanding the similarities and differences between TCRV GPC and glycoproteins from pathogenic arenaviruses is essential for vaccine development and therapeutic targeting:

FeatureTCRV GPCPathogenic Arenavirus GPC (e.g., JUNV)
Sequence homologyReferenceSignificant amino acid identity, especially in conserved functional domains
Post-translational processingSimilar pathwayComparable processing but with potential differences in efficiency or cellular factors
Neutralizing epitopesWell-characterizedOverlapping and unique epitopes; cross-neutralization possible
Receptor usageCell-type dependentMay use different cellular receptors; TfR1 for pathogenic New World arenaviruses
Fusion pH thresholdSpecific rangeMay have evolved different pH requirements for fusion activation

These comparative aspects have significant implications for cross-protection. Studies have shown that antibodies directed against envelope glycoproteins play an important role in protection against infection with JUNV and other New World arenaviruses . The antigenic relationship between TCRV and pathogenic arenaviruses provides a foundation for cross-protective immunity, though the extent varies between virus species.

The chimeric approach using TCRV as a backbone expressing glycoproteins from pathogenic arenaviruses represents a promising strategy to overcome limitations in cross-protection while maintaining the safety profile of TCRV .

What biosafety considerations apply when working with recombinant Tacaribe virus?

Working with recombinant TCRV requires appropriate biosafety measures, even though wild-type TCRV is considered relatively attenuated compared to pathogenic arenaviruses:

Biosafety Level Requirements:

  • Wild-type TCRV is typically handled at BSL-2

  • Recombinant TCRV expressing genes from pathogenic arenaviruses may require enhanced BSL-2 or BSL-3 containment depending on risk assessment

  • Institutional biosafety committee approval is essential for work with recombinant arenaviruses

Risk Assessment Considerations:

  • Genetic modifications: Introduction of genes from pathogenic viruses may alter virulence

  • Vector competence: Potential for altered host range or transmission characteristics

  • Environmental stability: Changes affecting persistence in the environment

  • Immune evasion: Modifications potentially affecting susceptibility to immune control

Specific Precautions:

  • Use of certified biosafety cabinets for all procedures producing aerosols

  • Proper waste decontamination protocols

  • Validated inactivation procedures before samples leave containment

  • Health monitoring for laboratory personnel

  • Clear documentation of all genetic modifications and safety testing results

It should be noted that TCRV has been associated with non-fatal, febrile laboratory-acquired infections of humans , underscoring the importance of proper biosafety practices even with this relatively attenuated virus.

What are the emerging approaches for studying TCRV GPC structure-function relationships?

Emerging technologies are expanding our capabilities to understand TCRV GPC structure-function relationships:

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy (cryo-EM): For high-resolution structures of GPC in different conformational states

  • X-ray crystallography: Of GPC domains or in complex with neutralizing antibodies

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map dynamic regions and conformational changes

  • Single-molecule FRET: To study real-time conformational dynamics during the fusion process

Genetic Approaches:

  • Deep mutational scanning: Systematic analysis of thousands of GPC mutants

  • CRISPR-Cas9 screening: To identify host factors critical for GPC function

  • Unnatural amino acid incorporation: For site-specific probing of GPC mechanics

These emerging approaches promise to deepen our understanding of how TCRV GPC mediates viral entry and interacts with the immune system, potentially revealing new targets for intervention and improving vaccine design.

How can computational modeling enhance TCRV GPC research?

Computational approaches offer powerful tools for TCRV GPC research:

Prediction and Design Applications:

  • Structure prediction: Using AlphaFold2 and RosettaFold to model GPC conformations

  • Epitope prediction: Computational identification of potential B and T cell epitopes

  • Molecular dynamics simulations: To understand GPC flexibility and conformational transitions

  • Virtual screening: To identify small molecule inhibitors targeting GPC

  • Immunogen design: Computational optimization of GPC-based immunogens

These computational approaches can accelerate experimental research by generating testable hypotheses about TCRV GPC function and immunogenicity, ultimately contributing to more effective vaccine and therapeutic development strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.