Recombinant Tachyglossus aculeatus aculeatus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetailsSource
Gene NameMT-ND6
UniProt IDQ8W9G2 (Tachyglossus aculeatus)
Protein LengthPartial (1–166 aa) or full-length (1–174 aa) constructs
Molecular Weight~18 kDa
TagDetermined during production (commonly His or Strep tags)
AA SequenceMMYFIYLLSVMLVLSFMAFASNPSPIYGGLSLVLSGGVGCGIIVSLGGSFLGLIVFLVYLGGMLVVFGYTAAMATEEYPETWVDY...

Production and Purification

Recombinant MT-ND6 is typically expressed in Escherichia coli or cell-free systems for high yield and purity.

  • Expression Systems:

    • E. coli: Achieves >85% purity (SDS-PAGE) with Tris/PBS-based buffers .

    • Cell-free synthesis: Enables post-translational modifications (e.g., AliCE® system) .

  • Purification:

    • Affinity chromatography (His/Strep tags) .

    • Shelf life: 6–12 months at -20°C/-80°C (lyophilized form) .

Functional and Biochemical Properties

MT-ND6 is integral to Complex I’s proton-pumping activity and NADH oxidation.

  • Role in Oxidative Phosphorylation:

    • Facilitates electron transfer from NADH to ubiquinone, driving ATP synthesis .

    • Mutations (e.g., m.14512_14513del) disrupt Complex I assembly, leading to mitochondrial diseases .

  • Enzymatic Activity:

    • EC 1.6.5.3; requires FMN and Fe-S clusters for redox reactions .

Table 1: Key Applications and Findings

ApplicationFindingsSource
Disease ModelingMT-ND6 variants linked to Leigh syndrome, LHON, and dystonia via Complex I deficiency .
Structural StudiesPartial constructs used to map transmembrane domains and redox centers .
Drug ScreeningEvaluated in assays targeting mitochondrial disorders (e.g., cytometric bead arrays) .

Research Highlights

  1. Leigh Syndrome Pathogenesis:

    • Heteroplasmic m.14512_14513del variants reduce NDUFB8 levels, impairing Complex I assembly .

  2. Evolutionary Conservation:

    • MT-ND6 loss correlates with fungal adaptation to oxidative stress and antifungal resistance .

  3. Structural Insights:

    • Cryo-EM studies highlight MT-ND6’s role in stabilizing Complex I’s hydrophobic core .

Challenges and Future Directions

  • Functional Assays: Lack of antibodies complicates direct protein quantification .

  • Therapeutic Targets: CRISPR-based correction of MT-ND6 mutations shows promise for mitochondrial diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of this product is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Tachyglossus aculeatus aculeatus (Southeast Australian short-beaked echidna)
Target Names
Target Protein Sequence
MMYFIYLLSVMLVLSFMAFASNPSPIYGGLSLVLSGGVGCGIIVSLGGSFLGLIVFLVYL GGMLVVFGYTAAMATEEYPETWVDYTVVLNLAIMVGMLGVVWYEFFEEVDLGVGYDLLDL GGMEVLGGDFNGVSLLYACGGWELVFSGWILFLTIFVVLEVTRGEH
Uniprot No.

Target Background

Function
This protein serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It plays a crucial role in catalyzing electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This process is essential for the catalytic activity and assembly of Complex I.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-ND6 in mitochondrial energy production?

MT-ND6 encodes NADH dehydrogenase 6, a crucial component of Complex I in the electron transport chain. This protein participates in the first step of electron transport, transferring electrons from NADH to ubiquinone. Within mitochondria, Complex I is embedded in the inner mitochondrial membrane and contributes to creating the electrochemical gradient necessary for ATP synthesis through oxidative phosphorylation. The protein helps establish an unequal electrical charge across the inner mitochondrial membrane by facilitating the step-by-step transfer of electrons, which ultimately provides energy for ATP production . Comparative analysis of MT-ND6 across species, including monotremes like Tachyglossus aculeatus aculeatus, reveals high conservation of functional domains, suggesting evolutionary importance in energy metabolism.

How is MT-ND6 different in Tachyglossus aculeatus aculeatus compared to human MT-ND6?

While the search results don't specifically compare echidna and human MT-ND6, research on mitochondrial genes typically reveals both conserved and divergent features across species. Mammalian MT-ND6 generally shows conservation of key functional domains, particularly at sites critical for electron transport. Amino acid residues at positions involved in ubiquinone binding and proton pumping tend to be highly conserved. Analysis of MT-ND6 sequences shows that certain positions (such as position 79, which is affected by the pathogenic m.14439G>A mutation in humans) are highly conserved among vertebrates . The conservation of these residues suggests their functional importance in the protein's activity within Complex I across diverse species.

What techniques are commonly used to isolate and purify recombinant MT-ND6?

Isolation of recombinant MT-ND6 typically involves a multi-step process beginning with gene cloning and expression. Researchers commonly clone the MT-ND6 gene sequence into expression vectors using PCR with primers designed for the specific sequence. For mitochondrial proteins like MT-ND6, both prokaryotic and eukaryotic expression systems may be employed, though eukaryotic systems often better accommodate post-translational modifications. Purification typically involves affinity chromatography, taking advantage of fusion tags (such as His-tags) engineered into the recombinant protein. For membrane proteins like MT-ND6, detergent solubilization is necessary during purification to maintain protein stability. Following initial purification, size exclusion chromatography or ion exchange chromatography may be used for further purification. Verification of purified protein can be performed using Western blotting with antibodies specific to MT-ND6 or to engineered epitope tags.

How can researchers quantify MT-ND6 expression levels in mitochondria?

Researchers typically employ a combination of techniques to quantify MT-ND6 expression. At the RNA level, quantitative RT-PCR can measure MT-ND6 transcript abundance, using appropriately designed primers as demonstrated in mitochondrial studies . For protein quantification, Western blotting with MT-ND6-specific antibodies provides relative quantification, while techniques like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) mass spectrometry can provide absolute quantification. For mitochondria-specific analysis, subcellular fractionation to isolate mitochondria is performed before quantification. Studies on mitochondrial genes often normalize expression to mitochondrial housekeeping genes (like mitochondrial rRNAs) or to mitochondrial mass markers to account for variations in mitochondrial content between samples. For recombinant proteins specifically, researchers can compare signals to known quantities of purified standards, as described in methodologies for quantifying recombinant RNA molecules .

What are the best experimental designs for studying MT-ND6 mutations using cybrid technology?

Cybrid technology represents a powerful approach for investigating MT-ND6 mutations by separating effects of mitochondrial DNA from nuclear DNA. An optimal experimental design would include multiple controls and carefully constructed cell lines. Begin by generating transmitochondrial cybrid cell lines, fusing enucleated patient cells (containing MT-ND6 mutations) with rho0 cells (lacking mtDNA) . Create multiple clonal lines with varying heteroplasmy levels (percentage of mutant mtDNA) to establish dose-response relationships between mutation load and phenotype. Essential controls include: isogenic cybrid lines with wild-type mtDNA, the original rho0 cell line, and when possible, cybrids with reintroduced wild-type mtDNA to demonstrate phenotypic rescue.

For Tachyglossus aculeatus MT-ND6 studies, researchers could generate xenocybrids by fusing echidna mitochondria with mammalian rho0 cells, though compatibility issues may arise. Alternatively, CRISPR-engineered mtDNA mutations in conserved residues can model echidna-specific variants. Comprehensive phenotypic analysis should include:

Assay TypeMeasurementsRelevance to MT-ND6 Function
Bioenergetic ProfilingComplex I activity, oxygen consumption, ATP productionDirectly assesses functional consequences of MT-ND6 mutations
ROS ProductionSuperoxide and hydrogen peroxide levelsAssesses downstream effects of dysfunctional Complex I
Mitochondrial MorphologyNetworks, fragmentation, cristae structureReveals structural adaptations to bioenergetic defects
Cell ViabilityUnder normal and stressed conditionsDetermines pathogenic threshold of mutations
Gene ExpressionNuclear retrograde signalingIdentifies compensatory mechanisms

This approach has successfully validated pathogenicity of MT-ND6 mutations, as demonstrated with the m.14439G>A mutation where cybrid analysis confirmed its causative role in Complex I deficiency .

How can researchers develop targeted approaches to modulate heteroplasmy levels in cells with MT-ND6 mutations?

Developing approaches to shift heteroplasmy levels (proportion of mutant to wild-type mtDNA) represents a promising therapeutic strategy for mitochondrial disorders. Several methodologies show potential for targeting MT-ND6 mutations. Mitochondrially-targeted nucleic acids offer sequence-specific approaches to reduce mutant mtDNA burden. Researchers can design oligoribonucleotides complementary to mutant mtDNA regions and deliver them into mitochondria using natural import pathways . This approach has demonstrated efficacy in reducing the proportion of mtDNA bearing large deletions in cybrid cells associated with Kearns Sayre Syndrome .

For MT-ND6 point mutations, researchers should consider these methodological steps:

  • Design sequence-specific oligonucleotides that selectively recognize mutant MT-ND6 sequences

  • Conjugate targeting sequences (like 5S RNA derivatives) to enable mitochondrial import

  • Optimize cellular delivery systems (transfection protocols or nanoparticle-based carriers)

  • Validate specificity using heteroplasmic cybrid models with varying mutation loads

  • Quantify shifts in heteroplasmy using sensitive methods like PCR-RFLP or digital droplet PCR

Efficiency of mitochondrial targeting can be assessed through subcellular fractionation followed by quantification methods such as Northern hybridization with sequence-specific probes or RT-PCR . Researchers should normalize imported RNA quantities to mitochondrial markers like tRNALeu to account for isolation variability . Functional recovery should be verified through Complex I activity assays and cellular bioenergetic profiles. This approach holds particular promise for point mutations in MT-ND6 associated with conditions like Leber hereditary optic neuropathy.

What are the challenges in determining the pathogenicity of novel MT-ND6 variants and how can they be addressed?

Determining the pathogenicity of novel MT-ND6 variants presents significant challenges due to the complexity of mitochondrial genetics. A comprehensive approach combines multiple lines of evidence to establish variant causality. Conservation analysis across species provides initial insight into functional importance—highly conserved residues typically indicate functional significance. For instance, pathogenic mutations like m.14439G>A affect proline at position 79, which is highly conserved among vertebrates .

Cybrid studies offer crucial functional evidence by transferring mitochondria with suspected pathogenic variants into a neutral nuclear background. This approach successfully confirmed pathogenicity of the m.14439G>A mutation in MT-ND6 by demonstrating consistent Complex I deficiency in cybrid cells . Conversely, the same methodology proved the m.1356A>G variant in 12S rRNA was non-pathogenic when Complex I activity was rescued in cybrids .

To comprehensively assess novel MT-ND6 variants, researchers should implement this systematic workflow:

Assessment LevelMethodologiesInterpretation Guidelines
GeneticHeteroplasmy quantification, population frequency, segregation analysisPathogenic variants often show high heteroplasmy in affected tissues and low population frequency
In silicoConservation analysis, structural modeling, pathogenicity prediction algorithmsVariants affecting highly conserved residues or critical functional domains merit further investigation
BiochemicalComplex I enzyme activity in patient tissues and cybrids>30% reduction in activity generally supports pathogenicity
MolecularOxygen consumption, ATP synthesis, ROS productionConsistent bioenergetic defects across multiple parameters strengthen evidence
Rescue studiesWild-type gene complementation, small molecule therapy responsePhenotypic rescue provides strongest evidence of causality

This multi-tiered approach increases confidence in pathogenicity assessments and reduces misclassification of benign variants as pathogenic or vice versa.

How can structural biology approaches elucidate the functional impact of MT-ND6 mutations?

Structural biology offers powerful insights into the molecular consequences of MT-ND6 mutations. Recent advances in cryo-electron microscopy have enabled high-resolution structures of mammalian Complex I, providing a framework for understanding how specific mutations disrupt function. Researchers studying MT-ND6 variants should combine structural analysis with functional studies to establish clear genotype-phenotype correlations.

For novel variants in Tachyglossus aculeatus MT-ND6, researchers can employ homology modeling based on resolved structures from closely related mammals. Molecular dynamics simulations can predict how mutations affect protein stability, ubiquinone binding, proton translocation, or Complex I assembly. Key parameters to analyze include changes in hydrogen bonding patterns, electrostatic surface properties, and conformational flexibility.

Critical structural features of MT-ND6 that warrant analysis include:

  • Transmembrane helices that form proton translocation channels

  • Residues at subunit interfaces that affect Complex I assembly

  • Regions involved in ubiquinone binding and electron transfer

  • Sites of protein-lipid interaction that influence membrane integration

The pathogenic mechanism of well-characterized mutations provides insight into structure-function relationships. For example, the common LHON-associated T14484C (Met64Val) variant likely disrupts ubiquinone interaction, while G14459A (Ala72Val) associated with Leigh syndrome may affect proton pumping or complex assembly . Correlating structural predictions with biochemical phenotypes observed in cybrids or patient samples strengthens mechanistic understanding of how specific residues contribute to MT-ND6 function.

What protocols should researchers follow to create recombinant MT-ND6 expression systems?

Establishing reliable expression systems for recombinant MT-ND6 requires careful consideration of several factors. MT-ND6 is a highly hydrophobic membrane protein with multiple transmembrane domains, making its expression and purification challenging. An effective protocol should address these methodological considerations:

For prokaryotic expression:

  • Gene synthesis and codon optimization for the expression host

  • Selection of appropriate vectors containing solubility tags (MBP, SUMO, or thioredoxin)

  • Expression in specialized E. coli strains designed for membrane proteins (C41(DE3), C43(DE3))

  • Induction at lower temperatures (16-18°C) to improve folding

  • Membrane fraction isolation followed by detergent screening for solubilization

For eukaryotic expression:

  • Baculovirus-insect cell systems that better accommodate membrane proteins

  • Mammalian expression systems with inducible promoters

  • Inclusion of appropriate mitochondrial targeting sequences if native localization is desired

Researchers should verify expression through Western blotting and assess protein functionality through complementation assays in cells with MT-ND6 deficiency. For studies requiring large amounts of purified protein, detergent selection is critical—mild detergents like DDM, LMNG, or digitonin tend to better preserve the native structure of membrane proteins like MT-ND6. Protein stability should be monitored throughout purification using techniques like size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS).

How can researchers effectively measure the impact of MT-ND6 variants on Complex I activity?

Accurate assessment of Complex I activity is essential for understanding MT-ND6 variant pathogenicity. A comprehensive approach combines multiple complementary assays to evaluate different aspects of Complex I function. Spectrophotometric assays measuring NADH oxidation provide a direct measurement of enzyme activity, typically normalized to citrate synthase activity to account for differences in mitochondrial content between samples .

Polarographic oxygen consumption measurements using substrate-specific protocols can distinguish between complex I-dependent and independent respiration pathways. For cell-based assays, researchers should implement this systematic protocol:

  • Prepare samples (isolated mitochondria, permeabilized cells, or tissue homogenates)

  • Measure basal Complex I activity using NADH:ubiquinone oxidoreductase assays

  • Determine specificity using Complex I inhibitors (rotenone)

  • Calculate activity relative to appropriate controls (citrate synthase)

  • Verify findings using alternative substrates (glutamate/malate vs. pyruvate/malate)

The table below outlines complementary approaches for comprehensive assessment:

Assay TypeParameters MeasuredAdvantagesLimitations
SpectrophotometricNADH oxidation rateQuantitative, high-throughputLimited to enzyme activity
Oxygen consumptionState 3/4 respiration, respiratory control ratioMeasures integrated functionRequires intact mitochondria
Mitochondrial membrane potentialΔψm using fluorescent dyesAssesses bioenergetic consequencesIndirect measure
ATP synthesisATP production rateFunctional output measurementMultiple complexes involved
Blue Native PAGEComplex I assemblyIdentifies assembly defectsSemi-quantitative

This multi-parametric approach has successfully characterized pathogenic MT-ND6 mutations, as demonstrated with the m.14439G>A variant where consistent Complex I deficiency was observed in both patient fibroblasts and derived cybrid cells .

What techniques can be used to study the interaction of MT-ND6 with other Complex I subunits?

Understanding subunit interactions within Complex I is crucial for elucidating how MT-ND6 variants impact assembly and function. Researchers can employ several complementary techniques to characterize these interactions. Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) provides a non-denaturing separation of intact complexes, allowing visualization of assembly intermediates that may accumulate with pathogenic MT-ND6 mutations. This can be followed by second-dimension SDS-PAGE to identify specific subunits affected by assembly defects.

Crosslinking mass spectrometry (XL-MS) offers higher-resolution insights by capturing direct protein-protein interactions. Chemical crosslinkers with varying spacer lengths can identify proximity relationships between MT-ND6 and other subunits. For even more detailed analysis, researchers can employ:

  • Co-immunoprecipitation with antibodies against MT-ND6 or interacting partners

  • Proximity labeling techniques like BioID or APEX2 fused to MT-ND6

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Single-particle cryo-electron microscopy of intact Complex I or subcomplexes

  • Förster resonance energy transfer (FRET) between fluorescently labeled subunits

For functional interactions, reconstitution experiments can determine minimal subunit requirements for activity. Researchers have used transmitochondrial cybrid technology to study how mtDNA-encoded subunits like MT-ND6 integrate with nuclear-encoded components . These studies have revealed that pathogenic mutations can disrupt not only catalytic function but also assembly and stability of the entire complex.

How can researchers design experiments to distinguish primary effects of MT-ND6 mutations from secondary consequences?

Distinguishing primary effects of MT-ND6 mutations from secondary adaptations requires carefully designed experimental approaches with appropriate controls and temporal analysis. Time-course studies represent a key strategy, allowing researchers to identify early events following mutation introduction before compensatory mechanisms develop. Inducible expression systems or nuclease-based approaches that allow controlled introduction of MT-ND6 variants enable precise temporal analysis.

Compartment-specific measurements help distinguish direct mitochondrial effects from secondary cellular responses. Multi-omics approaches provide comprehensive characterization:

Analytical ApproachPrimary Effect DetectionSecondary Effect Identification
ProteomicsChanges in Complex I subunit stoichiometryAltered expression of metabolic enzymes, stress response proteins
MetabolomicsNADH/NAD+ ratio changes, TCA cycle intermediate accumulationAdaptations in glucose metabolism, amino acid utilization
TranscriptomicsMitochondrial RNA processing defectsNuclear retrograde signaling, stress response pathways
LipidomicsAlterations in cardiolipin compositionMembrane remodeling, changes in lipid droplet formation

Genetic approaches to block specific signaling pathways can help differentiate primary from secondary effects. For example, inhibiting retrograde signaling while monitoring cellular responses to MT-ND6 mutations can reveal which phenotypes depend on nuclear responses versus direct mitochondrial dysfunction. Cybrid models with different nuclear backgrounds but identical mitochondrial mutations provide valuable insights by highlighting phenotypes that persist across nuclear contexts (likely primary effects) versus those that vary (potentially secondary adaptations) .

How can evolutionary analysis of MT-ND6 across species inform functional studies in Tachyglossus aculeatus?

Evolutionary analysis provides critical context for understanding MT-ND6 function in Tachyglossus aculeatus aculeatus. Monotremes like echidnas represent a unique mammalian lineage that diverged approximately 166 million years ago, potentially harboring distinctive adaptations in mitochondrial proteins. Comparative analysis across vertebrates reveals conservation patterns that highlight functionally critical residues. Positions that remain invariant across diverse lineages, including monotremes, marsupials, and placentals, likely represent essential structural or catalytic sites. The pathogenic human mutation m.14439G>A affects proline at position 79, which is highly conserved among vertebrates, indicating its functional importance .

Researchers studying echidna MT-ND6 should:

  • Perform multiple sequence alignments including diverse mammals and other vertebrates

  • Identify echidna-specific substitutions, particularly those in otherwise conserved regions

  • Map these substitutions onto structural models to predict functional implications

  • Design targeted experiments to test how these unique residues contribute to MT-ND6 function

This evolutionary approach can reveal how MT-ND6 has adapted to echidna-specific metabolic demands, potentially including adaptations for hibernation, temperature regulation, or diet. Studies of naturally occurring variants across species provide a complementary approach to disease-causing mutations, offering insights into functionally permissive versus deleterious changes. Positive selection analysis can identify residues under adaptive evolution that may contribute to echidna-specific physiological traits.

What considerations are important when designing gene therapy approaches targeting MT-ND6 mutations?

Developing gene therapy approaches for MT-ND6 mutations requires addressing several unique challenges associated with mitochondrial genetics. Unlike nuclear genes, direct replacement of mitochondrial genes is complicated by the difficulty in delivering DNA across both the cell and mitochondrial membranes. Alternative strategies focus on reducing heteroplasmy levels or providing functional complementation.

For heteroplasmy shifting approaches, researchers can utilize mitochondrially-targeted nucleic acids that selectively inhibit replication of mutant mtDNA, as demonstrated for large-scale mtDNA deletions . Key considerations include:

  • Delivery vehicle selection: Lipid nanoparticles, peptide-based carriers, or viral vectors

  • Mitochondrial targeting strategies: Fusion with natural import sequences or mitochondria-targeting peptides

  • Specificity for mutant versus wild-type mtDNA: Especially challenging for single nucleotide variants

  • Threshold effect considerations: Determining what level of heteroplasmy shift is therapeutically meaningful

  • Tissue-specific delivery: Targeting affected tissues (e.g., retinal ganglion cells for LHON-associated MT-ND6 mutations)

Preclinical testing should include careful assessment of off-target effects, immune responses, and long-term stability of therapeutic effects using appropriate animal models before clinical translation.

How might single-cell approaches advance our understanding of MT-ND6 variant effects on mitochondrial function?

Single-cell technologies offer unprecedented opportunities to understand the heterogeneity in mitochondrial function and MT-ND6 variant effects that are masked in bulk analysis. Mitochondrial heteroplasmy can vary significantly between individual cells, creating naturally occurring mosaics that provide insight into mutation threshold effects. By applying single-cell approaches, researchers can correlate specific heteroplasmy levels with functional outcomes at unprecedented resolution.

Advanced single-cell techniques applicable to MT-ND6 research include:

  • Single-cell RNA sequencing with mitochondrial transcript enrichment to capture MT-ND6 expression and nuclear retrograde responses

  • Imaging-based approaches using mitochondria-targeted fluorescent sensors to measure membrane potential, ROS production, and calcium dynamics in living cells

  • Single-cell proteomics to quantify Complex I subunit stoichiometry and post-translational modifications

  • Multimodal approaches that simultaneously measure genotype (heteroplasmy level) and phenotype (function) in the same cell

These techniques can reveal how identical MT-ND6 mutations cause variable phenotypes between cells, potentially explaining incomplete penetrance of mitochondrial diseases. By tracking single cells longitudinally, researchers can observe heteroplasmy shifts over time and correlate them with functional adaptations. This approach is particularly valuable for understanding tissue-specific manifestations of MT-ND6 mutations, as different cell types may exhibit different thresholds for dysfunction or compensatory capabilities.

What potential exists for using CRISPR-based approaches to model or correct MT-ND6 mutations?

CRISPR-based technologies are revolutionizing the ability to study and potentially treat mitochondrial DNA mutations, including those in MT-ND6. Recent breakthroughs in mitochondrial genome editing offer promising avenues for both disease modeling and therapeutic development. Mitochondrial base editors utilizing deaminase enzymes fused to mitochondrially-targeted TALE or zinc finger proteins can introduce specific point mutations modeling pathogenic MT-ND6 variants like m.14439G>A or T14484C .

For therapeutic applications, mitochondria-targeted restriction endonucleases or nucleases can selectively eliminate mutant mtDNA molecules, shifting heteroplasmy toward wild-type. DdCBE (DddA-derived cytosine base editors) and TALEN-based approaches have demonstrated efficacy in introducing precise edits in mtDNA. These technologies could potentially correct pathogenic MT-ND6 mutations associated with conditions like Leber hereditary optic neuropathy.

For Tachyglossus aculeatus research, CRISPR-based approaches offer several valuable applications:

  • Creating cellular or animal models with specific MT-ND6 variants to study evolutionary adaptations

  • Introducing human disease-associated mutations into conserved echidna MT-ND6 residues to assess functional consequences

  • Developing species-specific base editing systems optimized for monotreme mitochondrial genomes

  • Testing heteroplasmy shifting approaches in models of mitochondrial disease

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.