Recombinant Tachyoryctes splendens Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.

Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tachyoryctes splendens (East African mole rat)
Target Names
Target Protein Sequence
MAYPLQYGLQDATSPIMEELLHFHDHTLMIVFLISFLVLYVIFAMLSTKLTHTSTMDAQE VETIWTILPAVILVLIALPSLRILYMMDEIYNPALTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTTELKPGELRLLEVDNRVVLPMELPIRMLVSSEDVLHSWAVPSLGLKTDTIPGRLN QATLSSTRPGLFYGQCSEICGSNHSFMPIVLEMVPLKQFESWSATMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprising succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme A (subunit 1) to the binuclear center (BNC) in subunit 1. This BNC, composed of heme A3 and CuB, reduces molecular oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Tachyoryctes splendens Cytochrome c Oxidase Subunit 2?

Tachyoryctes splendens Cytochrome c Oxidase Subunit 2 (MT-CO2) is a mitochondrial protein encoded by the MT-CO2 gene (also known as COII or COXII). The protein is a critical component of the cytochrome c oxidase complex, which represents the terminal enzyme in the electron transport chain of mitochondrial oxidative phosphorylation. In Tachyoryctes splendens (East African mole rat), this protein consists of 227 amino acids and has a specific amino acid sequence that begins with MAYPLQYGLQ and continues through the entire protein structure . The protein plays a fundamental role in cellular energy production, catalyzing the reduction of oxygen to water while helping to generate the proton gradient necessary for ATP synthesis.

How does recombinant MT-CO2 differ from native MT-CO2?

Recombinant MT-CO2 is produced through expression in heterologous systems, typically using bacterial, yeast, or mammalian cell lines, rather than being isolated directly from Tachyoryctes splendens tissues. This recombinant protein maintains the primary amino acid sequence of the native protein but may include additional elements such as purification tags (though the specific tag type is determined during the production process) . The recombinant protein is stored in a Tris-based buffer with 50% glycerol, optimized for protein stability . While the amino acid sequence is preserved, post-translational modifications typical in the native environment might be absent depending on the expression system used. For research applications, recombinant proteins offer advantages of purity, consistent quality, and scalability compared to native protein isolation.

What are the optimal storage conditions for recombinant Tachyoryctes splendens MT-CO2?

Recombinant Tachyoryctes splendens MT-CO2 should be stored at -20°C for regular use, or at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which helps prevent freezing damage and maintain protein stability. To maximize protein integrity, repeated freeze-thaw cycles should be avoided. When actively working with the protein, aliquots can be maintained at 4°C for up to one week . When preparing aliquots, sterile conditions should be maintained, and protein concentration should be verified before long-term storage to account for any potential loss during the aliquoting process.

How can recombinant MT-CO2 be used in comparative studies of mitochondrial function across fossorial species?

Recombinant MT-CO2 from Tachyoryctes splendens provides a valuable tool for investigating mitochondrial adaptations in fossorial (burrowing) species. Researchers can use this protein in comparative biochemical assays to measure enzymatic activity, oxygen affinity, and electron transfer efficiency across different subterranean rodent species.

When designing such studies, researchers should consider the following methodological approach:

  • Perform parallel expression and purification of MT-CO2 from multiple fossorial species (e.g., Tachyoryctes splendens, Spalax ehrenbergi, Fukomys damarensis) under identical conditions.

  • Conduct enzymatic assays measuring cytochrome c oxidase activity under varying oxygen concentrations, replicating the hypoxic/hypercapnic conditions found in natural burrows.

  • Compare kinetic parameters (Km, Vmax) between species to identify potential adaptive differences.

  • Integrate findings with physiological data, such as the documented differences in total sleep time between fossorial species studied under normocapnic versus natural hypercapnic conditions .

This approach allows researchers to correlate molecular adaptations with physiological traits, such as the unique sleep patterns observed in Tachyoryctes splendens, which shows only 8.9 hours of total sleep time per day despite its fossorial lifestyle .

What considerations are important when designing ELISA assays using recombinant Tachyoryctes splendens MT-CO2?

When developing ELISA assays using recombinant Tachyoryctes splendens MT-CO2, researchers should address several critical methodological considerations:

  • Coating optimization: Determine the optimal concentration of recombinant MT-CO2 for plate coating (typically 1-10 μg/mL) through titration experiments.

  • Buffer selection: Test multiple coating buffers (carbonate/bicarbonate pH 9.6, PBS pH 7.4) to identify conditions that maximize protein adsorption while maintaining native conformation.

  • Blocking protocol: Optimize blocking conditions (BSA, non-fat milk, commercial blockers) to minimize background while preserving epitope accessibility.

  • Antibody validation: Validate antibody specificity against Tachyoryctes splendens MT-CO2 versus MT-CO2 from other rodent species to ensure selective detection.

  • Cross-reactivity assessment: Evaluate potential cross-reactivity with other mitochondrial proteins, particularly closely related cytochrome c oxidase subunits.

  • Standard curve preparation: Create a standard curve using serial dilutions of the recombinant protein (50 μg initial quantity can be divided to establish a full calibration range) .

For optimal results, storage aliquots of the recombinant protein should be prepared in advance to avoid freeze-thaw cycles that could affect protein integrity and assay reproducibility .

How can sequence analysis of MT-CO2 be used to understand evolutionary adaptations in subterranean rodents?

Sequence analysis of MT-CO2 can provide valuable insights into the evolutionary adaptations of subterranean rodents to their hypoxic/hypercapnic environment. Researchers should employ the following methodological framework:

  • Multiple sequence alignment: Align the amino acid sequence of Tachyoryctes splendens MT-CO2 with sequences from other subterranean rodents and non-fossorial relatives.

  • Identification of conserved domains: Map functionally critical regions based on the known sequence (MAYPLQLYGDATSPIMEELLHFHDHTLMIVFLIS...) .

  • Selection pressure analysis: Calculate dN/dS ratios to identify sites under positive selection that might confer adaptations to subterranean environments.

  • Structure-function correlation: Map sequence variations to the 3D structure of the cytochrome c oxidase complex to evaluate functional implications.

  • Comparative analysis with physiological data: Correlate sequence variations with documented physiological adaptations, such as the ability to tolerate elevated CO₂ levels (hypercapnia) reported in Tachyoryctes splendens and other subterranean rodents .

Research has shown that subterranean rodents like Tachyoryctes splendens naturally experience CO₂ levels up to 6.4% in their burrows compared to 0.04% in ambient air . This extreme environmental condition likely drives specific adaptations in mitochondrial proteins involved in cellular respiration.

What are the key considerations for reconstitution of lyophilized recombinant Tachyoryctes splendens MT-CO2?

When reconstituting lyophilized recombinant Tachyoryctes splendens MT-CO2, researchers should follow these methodological guidelines:

  • Temperature management: Allow the lyophilized protein to equilibrate to room temperature (20-25°C) before opening to prevent moisture condensation.

  • Buffer selection: Reconstitute in the recommended Tris-based buffer with 50% glycerol to maintain protein stability and prevent aggregation .

  • Gentle handling: Reconstitute by gentle pipetting rather than vortexing to minimize protein denaturation.

  • Concentration verification: After reconstitution, verify protein concentration using spectrophotometric measurement (A280 nm) or colorimetric protein assays.

  • Activity testing: Perform a pilot enzymatic activity assay to verify that the reconstituted protein maintains its functional properties.

  • Aliquoting strategy: Prepare multiple small-volume aliquots (≤20 μL) to minimize freeze-thaw cycles during subsequent use .

Most importantly, researchers should avoid repeated freezing and thawing of the protein solution, as this can lead to progressive loss of activity. Working aliquots should be stored at 4°C for up to one week, while long-term storage requires temperatures of -20°C or -80°C .

How can researchers validate antibody specificity for Tachyoryctes splendens MT-CO2 in immunological studies?

Validating antibody specificity for Tachyoryctes splendens MT-CO2 requires a comprehensive approach:

  • Western blot analysis: Test antibody reactivity against both recombinant Tachyoryctes splendens MT-CO2 and total mitochondrial extracts from Tachyoryctes splendens tissues.

  • Cross-reactivity assessment: Evaluate reactivity against recombinant MT-CO2 proteins from other rodent species such as Tatera robusta, Malacomys longipes, and Rhabdomys pumilio, which are also commercially available .

  • Epitope mapping: Determine the specific epitope(s) recognized by the antibody using peptide arrays or truncated protein variants.

  • Immunoprecipitation: Confirm specificity through immunoprecipitation followed by mass spectrometry identification.

  • Knockout/knockdown controls: If possible, use tissues from MT-CO2 knockout/knockdown models as negative controls.

  • Pre-absorption controls: Pre-absorb antibodies with recombinant Tachyoryctes splendens MT-CO2 prior to immunostaining to demonstrate specific signal reduction.

It's worth noting that antibodies raised against conserved regions of MT-CO2 may show cross-reactivity across multiple species due to the evolutionary conservation of this protein's functional domains.

How does MT-CO2 from Tachyoryctes splendens compare with other subterranean rodent species?

A comparative analysis of MT-CO2 across subterranean rodent species reveals important evolutionary and functional insights. The table below summarizes key comparisons:

SpeciesMT-CO2 Length (aa)HabitatSleep PatternsCO₂ Adaptation
Tachyoryctes splendens227 East African highlands8.9h total sleep time Adapted to burrow CO₂ levels up to 6.4%
Spalax ehrenbergi227Middle Eastern arid regions12.4h total sleep time High tolerance to hypercapnia
Fukomys damarensis227Southern African savannasVariableMeasured burrow CO₂ levels 0.4% average
Georychus capensis227South African coastal areas8.6h total sleep time Measured burrow CO₂ levels up to 6.4%
Non-fossorial rodents227-230Various surface habitats12-20h total sleep time Adapted to atmospheric CO₂ levels (0.04%)

What techniques can be used to study the impact of hypercapnia on MT-CO2 function in Tachyoryctes splendens?

Given that Tachyoryctes splendens naturally inhabits environments with elevated CO₂ levels, researchers can employ various techniques to study how hypercapnia affects MT-CO2 function:

  • Enzyme kinetics under varying CO₂ conditions: Measure cytochrome c oxidase activity using purified recombinant MT-CO2 under controlled CO₂ concentrations (ranging from 0.04% to 6.4%) .

  • Oxygen consumption analysis: Compare oxygen consumption rates in isolated mitochondria or tissue homogenates under normocapnic versus hypercapnic conditions.

  • Protein stability assays: Assess structural stability of recombinant MT-CO2 under different CO₂ concentrations using thermal shift assays or circular dichroism.

  • Cell culture models: Develop cell lines expressing Tachyoryctes splendens MT-CO2 and examine respiratory function under varying CO₂ levels.

  • Comparative physiology: Design experiments comparing physiological parameters between animals housed in normocapnic environments versus simulated burrow conditions (2-6% CO₂) .

Research has shown that CO₂ levels of 2% can increase total sleep time in mammals by 21%, while 6% CO₂ can decrease it by 41.2% . These findings suggest that the hypercapnic environment of natural burrows significantly impacts physiological functions, potentially including mitochondrial performance and energetics.

How might recombinant Tachyoryctes splendens MT-CO2 be used to study adaptations to climate change?

The study of recombinant Tachyoryctes splendens MT-CO2 offers valuable insights into potential adaptations to climate change, particularly regarding increasing atmospheric CO₂ levels:

  • Comparative functional analysis: Researchers can compare the functional properties of MT-CO2 from Tachyoryctes splendens with non-fossorial species to identify molecular mechanisms of adaptation to elevated CO₂.

  • Mutagenesis studies: Create site-directed mutations in recombinant MT-CO2 based on sequence differences between fossorial and non-fossorial species to identify key residues involved in hypercapnia adaptation.

  • Phenotypic screening: Develop cellular models expressing wild-type or mutant Tachyoryctes splendens MT-CO2 to screen for phenotypes related to hypercapnia resistance.

  • Physiological correlation: Integrate molecular findings with whole-organism physiological data, such as the observation that subterranean rodents living in hypercapnic environments exhibit altered sleep patterns compared to those in normocapnic laboratory conditions .

Research has noted that "given that we face an increase in the CO₂ levels we breathe associated with global warming, total sleep time for humans may increase over time. Understanding the relationship between CO₂ levels and sleep and how to accommodate to these changes, may be of importance to humans in the future. The subterranean mole rats may be good model species to augment our understanding of sleep in a hypercapnic environment" . This suggests that molecular studies of MT-CO2 from these species could have broader implications for understanding human physiological responses to changing atmospheric conditions.

What are the challenges in expressing and purifying functional recombinant Tachyoryctes splendens MT-CO2?

Researchers face several methodological challenges when expressing and purifying functional recombinant Tachyoryctes splendens MT-CO2:

  • Expression system selection: MT-CO2 is typically a membrane-associated protein, making soluble expression challenging. Researchers must optimize between bacterial, yeast, or mammalian expression systems based on requirements for post-translational modifications and membrane insertion.

  • Codon optimization: The Tachyoryctes splendens gene sequence may contain codons that are rare in standard expression hosts, necessitating codon optimization for efficient expression.

  • Protein folding: As a membrane protein component, ensuring proper folding during recombinant expression can be difficult and may require specialized detergents or lipid environments.

  • Functional reconstitution: To study enzymatic activity, recombinant MT-CO2 often needs to be reconstituted with other cytochrome c oxidase subunits to form a functional complex.

  • Tag interference: While purification tags facilitate isolation, they may interfere with protein function, requiring optimization of tag type and position or post-purification tag removal .

  • Storage stability: Maintaining functional stability during storage requires optimization of buffer composition, typically involving 50% glycerol and specific Tris-based formulations .

These challenges underscore the importance of careful experimental design when working with recombinant MT-CO2, particularly when the research goal is to maintain native functional properties rather than simply obtaining the protein for structural or immunological studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.