Recombinant Tadarida brasiliensis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Sequence Information

FeatureDetails
Full-length sequenceMTNIRKSHPLIKIINDAFIDLPAPSNISSWWNFGSLLGVCLAVQILTGLFLAMHYTSDTA...
Expression region1–176 (common variant) or 1–199 (full-length)
Molecular weight~20–25 kDa (depending on truncation)

Production and Purification

Recombinant MT-CYB is produced in Escherichia coli expression systems, enabling scalable yields.

Key Production Parameters

ParameterDetails
Expression systemE. coli (BL21 or similar strains)
TagN-terminal 10× His-tag for affinity chromatography
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Notes:

  • Repeated freeze-thaw cycles degrade protein stability; aliquots stored at -80°C are recommended .

  • Reconstitution in deionized water with 50% glycerol enhances solubility .

Role in Mitochondrial Electron Transport

MT-CYB facilitates electron transfer from ubiquinol to cytochrome c within Complex III, driving proton gradient formation for ATP synthesis . Mutations in MT-CYB disrupt oxidative phosphorylation, leading to pathologies such as cardiomyopathy and exercise intolerance in humans .

Comparative Analysis

SpeciesMT-CYB MutationPhenotypic Impact
Homo sapiensm.14864 T>C (C40R)MELAS-like syndrome
Homo sapiensm.14757T>C (M4T)Dilated cardiomyopathy
Tadarida brasiliensisRecombinant wild-typeStable enzymatic activity

Structural Stability: The hydrophobic methionine at position 4 in humans is replaced by polar threonine in some bat variants, altering physicochemical properties without destabilizing the complex .

Current Uses

  • Enzyme activity assays: Measuring Complex III functionality in mitochondrial isolates .

  • Antibody production: Serving as an antigen for anti-cytochrome b antibodies .

  • Structural studies: Crystallization trials to resolve electron transport mechanisms .

Limitations

  • Tissue-specific activity: Cardiac and skeletal muscle isoforms may differ, limiting extrapolation to other tissues .

  • Species variability: Bat-derived MT-CYB exhibits <80% sequence homology with human orthologs, necessitating cautious cross-species comparisons .

Future Directions

  • Pathogenicity studies: Testing bat-derived MT-CYB in models of mitochondrial disease .

  • Viral interaction screens: Investigating SARS-CoV-2 susceptibility in bat mitochondrial pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Tadarida brasiliensis (Brazilian free-tailed bat)
Target Names
Target Protein Sequence
MTNIRKSHPLIKIINDAFIDLPAPSNISSWWNFGSLLGVCLAVQILTGLFLAMHYTSDTA TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHVGRGLYYGSYTYTETWNVGIILL FAVMATAFMGYVLPWGQMSFWGATVITNLLFAIPYIGTDLVEWIWGGFSVDKATLT
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Tadarida brasiliensis Cytochrome b (MT-CYB)?

Recombinant Tadarida brasiliensis Cytochrome b (MT-CYB) is a synthetically produced protein corresponding to the cytochrome b found in the mitochondrial genome of Brazilian free-tailed bats (Tadarida brasiliensis). The protein is a transmembrane component that functions as part of Complex III in the electron transport chain. It is also known by several alternative names including Complex III subunit 3, Cytochrome b-c1 complex subunit 3, and Ubiquinol-cytochrome-c reductase complex cytochrome b subunit . The recombinant form is typically produced using in vitro E.coli expression systems and includes an N-terminal 10xHis-tag for purification purposes .

How stable is recombinant MT-CYB and what are the optimal storage conditions?

Recombinant MT-CYB has specific storage requirements to maintain stability and functionality. For general storage, the protein should be kept at -20°C, while extended storage is recommended at -20°C or -80°C . The shelf life varies depending on storage conditions: liquid form typically maintains stability for approximately 6 months at -20°C/-80°C, while lyophilized preparations can remain stable for up to 12 months at these temperatures . Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided; working aliquots can be maintained at 4°C for up to one week . These parameters are essential for experimental planning, particularly for studies requiring consistent protein quality over extended periods.

How can MT-CYB be used in population genetics and phylogenetic studies?

MT-CYB serves as a valuable genetic marker for population genetics and phylogenetic studies of Tadarida brasiliensis due to its moderate evolutionary rate and conservation across mammalian species. Research has identified significant genetic variation in cytochrome b sequences, with studies reporting 77 polymorphic sites and an average nucleotide diversity of 0.028 across populations . Analysis of these sequences has revealed 17 unique haplotypes in Tadarida brasiliensis populations .

Methodologically, researchers should:

  • Extract mitochondrial DNA from tissue samples (typically muscle tissue)

  • Amplify the cytochrome b gene using species-specific primers

  • Sequence the amplicons using next-generation sequencing platforms (e.g., Illumina NextSeq)

  • Assemble sequences using bioinformatics tools such as Geneious

  • Annotate sequences using specialized software like DOGMA

  • Conduct phylogenetic analysis to determine evolutionary relationships

This approach has been successfully employed to identify population structure between geographical regions and even to detect potential cryptic species within what was previously considered a single species .

What experimental controls should be included when working with recombinant MT-CYB in functional assays?

When designing functional assays involving recombinant MT-CYB, researchers should implement the following controls:

  • Negative controls:

    • Buffer-only controls to establish baseline measurements

    • Heat-denatured MT-CYB to confirm activity loss

    • E. coli expression system extracts without the MT-CYB insert

  • Positive controls:

    • Commercial cytochrome b preparations from well-characterized species

    • Previously validated batches of MT-CYB with known activity levels

  • Technical controls:

    • His-tag only protein to assess the impact of the purification tag

    • Dose-response curves to establish linearity of response

    • Time-course experiments to determine optimal reaction times

These controls help distinguish MT-CYB-specific effects from artifacts and ensure experimental reproducibility across different laboratory settings and protein preparations.

How can MT-CYB sequence data inform our understanding of bat evolutionary history and speciation events?

Cytochrome b sequence analysis has revealed unexpected population structure in Tadarida brasiliensis across geographic regions. Studies examining populations across Florida and The Bahamas identified distinct genetic lineages with substantial divergence, contrary to predictions based on the species' high mobility . Specifically, two distinct groups of T. brasiliensis were identified across different island groups in The Bahamas, suggesting ancient divergence followed by secondary contact .

For researchers investigating bat evolutionary history:

  • Implement phylogeographic approaches that integrate MT-CYB sequence data with ecological and morphological information

  • Compare MT-CYB sequences across multiple bat species to establish divergence times

  • Analyze synonymous vs. non-synonymous substitution rates to identify signatures of selection

  • Combine MT-CYB data with nuclear markers to develop robust species trees

  • Apply coalescent-based methods to estimate historical population sizes and gene flow

This multifaceted approach has identified potential cryptic species within T. brasiliensis in the West Indies, demonstrating how MT-CYB analysis contributes to taxonomic revisions and enhanced understanding of chiropteran diversity .

What are the methodological challenges in comparing MT-CYB mutations across different bat species and their potential implications for disease research?

Comparing MT-CYB mutations across bat species presents several methodological challenges that researchers must address:

  • Sequence homology determination:

    • Implement appropriate alignment algorithms for transmembrane proteins

    • Use structure-based alignments where possible to account for functional domains

    • Apply codon-based alignment methods to maintain reading frames

  • Heteroplasmy detection:

    • Develop protocols to detect and quantify heteroplasmic variants (as seen in human MT-CYB mutations)

    • Establish minimum thresholds for variant calling from next-generation sequencing data

    • Validate variants using multiple sequencing approaches

  • Functional assessment:

    • Design in vitro assays to assess the impact of mutations on electron transport

    • Develop cybrid cell lines to study mutations in a controlled nuclear background

    • Implement computational prediction tools calibrated for bat mitochondrial proteins

The importance of these methods extends beyond evolutionary studies to disease research, as mutations in MTCYB have been associated with various pathologies in humans, including mitochondrial myopathy and MELAS-like syndromes . Understanding how bats tolerate certain mutations may provide insights into mitochondrial disease mechanisms and potential therapeutic approaches.

How can recombinant MT-CYB be used to study the relationship between mitochondrial function and immune response in bats?

Recent research has established connections between mitochondrial function and immune responses in bats, offering a promising avenue for investigating their unique immunological properties. To investigate these relationships using recombinant MT-CYB:

  • Functional immune assays:

    • Measure bactericidal activity of whole blood from bats with different MT-CYB haplotypes

    • Assess T-cell mediated responses through mitogenic challenge experiments

    • Correlate MT-CYB sequence variants with observed immune parameters

  • Experimental design considerations:

    • Account for ecological variables (roosting ecology has been shown to influence immune parameters)

    • Control for colony-level effects which may confound individual measurements

    • Implement longitudinal sampling to capture seasonal variation

  • Mechanistic investigations:

    • Use recombinant MT-CYB in cellular models to assess mitochondrial ROS production

    • Examine how specific variants affect electron transport efficiency and immune signaling

    • Develop bat-specific cell lines for controlled in vitro experiments

Studies have demonstrated significant variation in both innate and adaptive immune responses among T. brasiliensis populations from different roost types, suggesting complex relationships between ecology, genetics, and immunity . The negative correlation observed between bactericidal activity and T-cell mediated response indicates potential trade-offs in immune function that may be influenced by mitochondrial efficiency .

What are the optimal expression systems and purification strategies for obtaining functional recombinant MT-CYB?

Producing functional recombinant MT-CYB presents unique challenges due to its transmembrane nature. Based on current protocols:

  • Expression systems:

    • E. coli: Currently the most common system, usually with BL21(DE3) strains optimized for membrane proteins

    • Alternative systems to consider include baculovirus-infected insect cells or mammalian expression systems for more native-like post-translational modifications

  • Expression optimization:

    • Reduce expression temperature (16-20°C) to slow folding and prevent inclusion body formation

    • Use specialized media formulations (e.g., Terrific Broth with supplements)

    • Test induction conditions (IPTG concentration and timing) extensively

  • Purification strategy:

    • Initial capture using Ni-NTA affinity chromatography targeting the N-terminal 10xHis-tag

    • Membrane protein-specific detergents (DDM, LDAO) for solubilization

    • Size exclusion chromatography as a polishing step

    • Consider amphipol exchange for increased stability

  • Quality control:

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to assess stability

    • Functional assays measuring electron transfer capability

These methodological considerations are essential for obtaining high-quality protein preparations suitable for structural and functional studies.

How can MT-CYB sequence data be effectively integrated with whole mitochondrial genome analyses?

Integrating MT-CYB sequence data with whole mitochondrial genome analyses requires sophisticated bioinformatic approaches:

  • Data generation and processing:

    • Extract mitochondrial DNA using specialized kits (e.g., Abcam Mitochondrial DNA Isolation Kit)

    • Sequence using high-throughput platforms (Illumina NextSeq)

    • Assemble sequences using software packages like Geneious

    • Annotate using specialized tools such as DOGMA

  • Analytical framework:

    • Assess congruence between MT-CYB-based phylogenies and those derived from whole mitochondrial genomes

    • Implement partitioned analyses to account for different evolutionary rates across mitochondrial genes

    • Use statistical tests to identify regions under selection or showing unusual evolutionary patterns

  • Integrated approaches:

    • Combine mitochondrial data with nuclear markers for comprehensive evolutionary analyses

    • Map MT-CYB variants onto the 2.28 Gb Tadarida brasiliensis genome assembly

    • Correlate mitochondrial variation with nuclear gene expression patterns

This integrated approach provides a more comprehensive understanding of evolutionary processes and can reveal selection pressures acting on different components of the mitochondrial genome.

How might MT-CYB comparative analyses contribute to conservation efforts for Tadarida brasiliensis populations?

Tadarida brasiliensis populations have declined by 50-100% in some regions over the past century due to habitat loss, roost disturbance, and pesticide exposure . MT-CYB comparative analyses can contribute to conservation efforts through several approaches:

  • Population genetic assessment:

    • Identify genetically distinct populations deserving separate conservation attention

    • Estimate effective population sizes and historical bottlenecks

    • Measure gene flow between populations to inform corridor planning

  • Monitoring methodologies:

    • Develop non-invasive sampling protocols using environmental DNA (eDNA) from roosting sites

    • Design qPCR assays targeting MT-CYB for rapid population identification

    • Establish baseline genetic diversity metrics for long-term monitoring

  • Functional significance:

    • Investigate whether MT-CYB variants correlate with fitness metrics in different environments

    • Assess potential adaptation to local conditions, including temperature regimes and food resources

    • Evaluate possible relationships between genetic diversity and disease resistance

By identifying cryptic diversity and population structure through MT-CYB analysis , conservation biologists can develop more targeted and effective management strategies that account for evolutionary distinct lineages rather than treating T. brasiliensis as a homogeneous entity.

What potential exists for using recombinant MT-CYB in structural biology studies, and what technical challenges must be overcome?

Structural studies of recombinant MT-CYB face significant challenges but offer valuable insights into mitochondrial function:

  • Current structural knowledge:

    • While no bat-specific MT-CYB structure exists, homology modeling can leverage structures from other mammals

    • Expression region 1-176 of the recombinant protein represents only a portion of the full transmembrane protein

  • Technical approaches:

    • Cryo-electron microscopy of reconstituted complexes containing MT-CYB

    • X-ray crystallography following stabilization with antibody fragments

    • NMR studies of specific domains using isotopically labeled protein

    • Molecular dynamics simulations to analyze conformational flexibility

  • Challenges to overcome:

    • Protein stability in detergent micelles or membrane mimetics

    • Obtaining sufficient quantities of properly folded protein

    • Preventing aggregation during concentration

    • Establishing functional assays to verify native-like structure

  • Potential applications:

    • Comparing MT-CYB structures across species with different metabolic rates

    • Investigating how specific mutations affect electron transport

    • Identifying potential binding sites for therapeutic compounds targeting mitochondrial diseases

Structural insights could significantly advance our understanding of how variations in cytochrome b contribute to the unique physiological adaptations observed in bats, such as their exceptional longevity and metabolism.

What are the most promising future research directions involving Tadarida brasiliensis MT-CYB?

The most promising future research directions for Tadarida brasiliensis MT-CYB span multiple disciplines:

  • Ecological immunology:

    • Further investigation of the relationship between MT-CYB variants and immune function

    • Exploration of how mitochondrial efficiency influences disease resistance

    • Studies of how environmental factors interact with genetic variation to shape immune responses

  • Evolutionary genomics:

    • Integration of MT-CYB data with whole genome analyses

    • Comparative studies across the Molossidae family to understand adaptive evolution

    • Investigation of positive selection signatures in bat mitochondrial genomes

  • Disease ecology:

    • Analysis of how MT-CYB variation might relate to pathogen resistance

    • Studies of potential connections to white-nose syndrome susceptibility

    • Exploration of bat-pathogen coevolution through mitochondrial adaptations

  • Conservation applications:

    • Development of genetic monitoring tools for population assessment

    • Integration of genetic data with ecological modeling to predict climate change impacts

    • Establishment of genetic management guidelines based on evolutionary significant units

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.