Recombinant Taeniopygia guttata Apoptosis-inducing factor 2 (AIFM2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
AIFM2; Ferroptosis suppressor protein 1; FSP1; Apoptosis-inducing factor homologous mitochondrion-associated inducer of death; AMID; p53-responsive gene 3 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Taeniopygia guttata (Zebra finch) (Poephila guttata)
Target Names
AIFM2
Target Protein Sequence
MGSRLSLDGSVRVVVVGGGFGGTAAASLLKSWAVPFVLVDVRDAFHHNVAALRAAVESGF AKKTFISYSVTFGDSFRQGKVVAIDPGRQQVVLSDGEELHYSHLILATGSDGPFPGKFNQ VIDMESAIQTYEDMVKEIEKSQRILVVGGGAAGVEMAAEIKTEYPGKEIILIHSKTALAD VELLPSVRQVVKEILLRKGVRLLLSEKVSDIENLRPNQFQKDMVVRTEKGTEVVVDMVVL CTGIKINSSAYAAAFGDKMASDGALKVNKHLQLEGYENIYAIGDCADLKEPKMAYHAGLH ANVVVTNIINSLTQKPLKTYEPGSLTFLLSMGRNDGVGQVNGYYVGRLLVTIAKSRDLFV SKSWRTMGQTMPS
Uniprot No.

Target Background

Function

A NAD(P)H-dependent oxidoreductase involved in the cellular oxidative stress response. At the plasma membrane, it catalyzes the reduction of coenzyme Q/ubiquinone-10 to ubiquinol-10, a lipophilic radical-trapping antioxidant that prevents lipid peroxidation and subsequent ferroptosis. It cooperates with GPX4 to suppress phospholipid peroxidation and ferroptosis, independently of cellular glutathione levels. It may also play a role in mitochondrial stress signaling. Under oxidative stress, it associates with the lipid peroxidation end product 4-hydroxy-2-nonenal (HNE), forming an inactive lipid adduct. This adduct then translocates from the mitochondria to the nucleus, inducing DNA damage and cell death. The protein exhibits non-sequence-specific DNA binding capability.

Database Links
Protein Families
FAD-dependent oxidoreductase family
Subcellular Location
Lipid droplet. Cell membrane; Lipid-anchor. Cytoplasm. Mitochondrion membrane. Nucleus.

Q&A

What is the structural and functional characterization of Taeniopygia guttata AIFM2?

Taeniopygia guttata (Zebra finch) Apoptosis-inducing factor 2 (AIFM2) is a flavoprotein oxidoreductase that belongs to the mitochondrion-associated apoptosis-inducing factor family. Structurally, AIFM2 contains a conserved Pyr_redox_2 domain which is critical for its oxidoreductase activity. Unlike some other apoptotic factors, AIFM2 possesses the ability to bind single-stranded DNA, contributing to its role in apoptosis particularly in the presence of bacterial and viral DNA . The protein contains conserved NADH- and FAD-binding domains essential for its oxidoreductase function, similar to what has been observed in other species like sea cucumber Holothuria leucospilota . In terms of localization signaling, AIFM2 typically contains a putative C-terminal nuclear localization sequence (NLS), but unlike some other apoptotic factors, it may lack an N-terminal mitochondrial localization sequence (MLS) . This structural arrangement facilitates its translocation between cellular compartments during the apoptotic process.

How does AIFM2 contribute to apoptotic pathways in Taeniopygia guttata compared to other species?

AIFM2 in Taeniopygia guttata contributes to a caspase-independent apoptotic pathway, serving as an alternative mechanism to the classical caspase-dependent process. When examining the role of AIFM2 across species, several conserved functions can be observed alongside species-specific adaptations. In vertebrates, including Zebra finch, AIFM2 is thought to contribute to apoptosis through direct DNA binding and subsequent chromatin condensation . Comparative analysis with research on sea cucumber AIF-2 indicates that upon cellular stress, such as exposure to heavy metals like cadmium, AIF-2 translocates from the cytoplasm to the nucleus to execute its apoptotic function . This nuclear translocation pattern appears to be conserved across species. Additionally, AIFM2 is induced by the tumor suppressor protein p53 in various species, including in colon cancer cells in mammals, suggesting conservation of regulatory mechanisms across evolutionarily distant organisms . Unlike the traditional apoptotic pathways that rely on caspase activation, AIFM2-mediated cell death represents an ancient evolutionary mechanism that may be particularly important in response to specific cellular stressors.

What are the recommended protocols for expressing and purifying recombinant Taeniopygia guttata AIFM2?

For optimal expression and purification of recombinant Taeniopygia guttata AIFM2, researchers should consider the following methodological approach:

Expression Systems:
Several expression systems have proven effective for AIFM2 production, with E. coli, mammalian cells (particularly HEK293), and insect cells being the most commonly used platforms . For structural and basic functional studies, bacterial expression in E. coli provides high yields, whereas mammalian expression systems may preserve post-translational modifications important for certain functional studies.

Purification Protocol:

  • Clone the AIFM2 coding sequence into an appropriate expression vector containing an affinity tag (His, GST, or DDK tags have all been successfully used with AIFM2)

  • Transform into the chosen expression system and induce protein expression

  • Lyse cells under native conditions (preferably using non-ionic detergents)

  • Perform affinity chromatography using the corresponding affinity matrix

  • Consider a secondary purification step using ion exchange or size exclusion chromatography

  • Verify protein identity using Western blotting and mass spectrometry

  • Assess protein activity through enzymatic assays targeting oxidoreductase function

For functional studies where proper folding and cofactor binding are critical, inclusion of FAD during the purification process may enhance the quality of the purified protein. When designing experiments with recombinant AIFM2, it's advisable to perform both reduced and non-reduced SDS-PAGE analysis to assess the potential formation of disulfide bonds that might affect protein function.

How can researchers effectively study AIFM2 translocation in response to apoptotic stimuli in avian cell models?

Studying AIFM2 translocation in avian cell models requires sophisticated experimental approaches that capture the dynamic nature of this process. Based on methodologies applied in related research, the following comprehensive approach is recommended:

Experimental Design for AIFM2 Translocation Studies:

  • Cell Model Selection and Preparation:

    • Primary avian cell cultures derived from Taeniopygia guttata tissues provide the most physiologically relevant model

    • Alternatively, establish stable avian cell lines expressing fluorescently-tagged AIFM2 (e.g., GFP-AIFM2 fusion proteins)

    • For comparative analysis, parallel studies in mammalian cells like HEK293T can provide valuable insights

  • Apoptotic Stimuli Application:

    • Test multiple apoptotic stimuli including:
      a) Heavy metals (CdCl₂ has been demonstrated to induce AIF-2 translocation)
      b) DNA-damaging agents (UV irradiation, cisplatin)
      c) Oxidative stress inducers (H₂O₂, paraquat)
      d) Pathogen-associated molecular patterns (PAMPs), though evidence suggests these may not directly trigger AIFM2 translocation

  • Subcellular Localization Tracking Methodologies:

    • Live cell imaging using confocal microscopy for real-time tracking of fluorescently-tagged AIFM2

    • Subcellular fractionation followed by Western blotting to quantify AIFM2 distribution between cytoplasmic and nuclear fractions

    • Immunofluorescence staining of fixed cells using anti-AIFM2 antibodies

    • Co-localization studies with compartment-specific markers (nuclear, mitochondrial, cytoplasmic)

  • Quantitative Analysis:

    • Develop algorithms for quantifying nuclear/cytoplasmic ratios of AIFM2 over time

    • Establish time-course studies to determine the kinetics of translocation

    • Correlate translocation events with measurable outcomes of apoptosis

Research in other models has revealed that AIFM2 protein transitions from cytoplasmic to nuclear localization upon apoptotic stimulation, particularly in response to heavy metal exposure . This translocation is a critical event in the execution of caspase-independent apoptosis, and quantifying both its timing and extent provides valuable insights into the mechanism of action of this protein in avian systems.

What approaches should be used to investigate the interaction between AIFM2 and p53 in avian cancer models?

Investigating the interaction between AIFM2 and p53 in avian cancer models requires multifaceted approaches that address both physical interactions and functional relationships. Based on established knowledge that AIFM2 expression is induced by tumor suppressor protein p53 in colon cancer cells , the following methodological framework is recommended:

Comprehensive Methodology for AIFM2-p53 Interaction Studies:

  • Physical Interaction Analysis:

    • Co-immunoprecipitation (Co-IP) assays using antibodies against either AIFM2 or p53

    • Proximity ligation assay (PLA) to visualize and quantify interactions in situ

    • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for live-cell interaction studies

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for binding kinetics using purified recombinant proteins

  • Transcriptional Regulation Analysis:

    • Chromatin immunoprecipitation (ChIP) to determine p53 binding to the AIFM2 promoter region

    • Luciferase reporter assays with wild-type and mutated AIFM2 promoter constructs

    • qRT-PCR and Western blot analysis to quantify AIFM2 expression changes following p53 activation or inhibition

    • CRISPR-based approaches to introduce specific mutations in p53 binding sites within the AIFM2 promoter

  • Functional Consequence Assessment:

    • Knockdown/knockout studies of either p53 or AIFM2 followed by phenotypic analysis

    • Rescue experiments to determine if AIFM2 overexpression can restore apoptotic function in p53-deficient cells

    • Analysis of apoptotic markers and cell viability in response to genotoxic stress under conditions of p53 and/or AIFM2 modulation

    • Comparison of DNA binding capacity of AIFM2 in the presence and absence of functional p53

  • Avian Cancer Model Applications:

    • Development of avian cell lines with p53 mutations mirroring those found in human cancers

    • Analysis of AIFM2 expression patterns in spontaneous avian tumors with varying p53 status

    • Comparison of p53-AIFM2 pathway functionality across evolutionary diverse species

The p53-AIFM2 regulatory axis represents a critical juncture in cellular responses to stress and DNA damage, with AIFM2 functioning as a p53-responsive gene involved in the execution of apoptosis . Understanding this relationship in avian systems not only illuminates species-specific aspects of apoptotic regulation but may also provide evolutionary insights into this fundamental cellular process.

How can researchers effectively analyze the oxidoreductase activity of recombinant Taeniopygia guttata AIFM2 in vitro?

The oxidoreductase activity of recombinant Taeniopygia guttata AIFM2 represents a critical functional aspect of this protein that requires specialized assays and careful experimental design. Based on the conserved nature of NADH- and FAD-binding domains in AIFM2 , the following comprehensive methodology is recommended:

Enzymatic Activity Analysis Protocol:

  • Spectrophotometric NADH Oxidation Assay:

    • Measure the decrease in absorbance at 340 nm as NADH is oxidized to NAD+

    • Reaction mixture: Purified recombinant AIFM2, NADH (150-200 μM), appropriate buffer (typically pH 7.4)

    • Control reactions should include denatured enzyme and reactions without substrate

    • Calculate enzyme kinetics parameters (Km, Vmax) using varying NADH concentrations

  • Electron Acceptor Specificity Assessment:

    • Test various electron acceptors including:
      a) Cytochrome c
      b) Molecular oxygen
      c) Artificial electron acceptors (e.g., ferricyanide, dichlorophenolindophenol)

    • Compare reaction rates to determine preferential electron acceptor pathways

  • Flavin Analysis:

    • Spectral analysis of purified AIFM2 (350-700 nm) to confirm FAD incorporation

    • Assess FAD:protein ratio through protein quantification and flavin fluorescence

    • Determine if FAD is covalently or non-covalently bound through acid precipitation methods

  • ROS Production Assessment:

    • Measure hydrogen peroxide generation using Amplex Red/horseradish peroxidase assay

    • Determine superoxide production using cytochrome c reduction assay in the presence and absence of superoxide dismutase

    • Correlate ROS production with oxidoreductase activity under various conditions

  • Inhibitor Studies:

    • Test canonical flavoenzyme inhibitors (e.g., diphenyleneiodonium)

    • Analyze competitive inhibition by NAD+ and structural analogs

    • Investigate the effects of potential physiological regulators

  • Environmental Condition Effects:

    • Determine optimal pH, temperature, and ionic strength

    • Assess the effects of oxidizing and reducing conditions on enzyme activity

    • Evaluate the impact of potential physiological regulators (e.g., metal ions)

The table below summarizes expected parameters for recombinant AIFM2 oxidoreductase activity:

ParameterExpected RangePhysiological Significance
Km for NADH10-50 μMAffinity for reducing substrate
Optimal pH7.0-8.0Cytoplasmic/nuclear function
Temperature optimum37-42°C (for avian proteins)Species adaptation
FAD:protein ratio0.8-1.0Cofactor incorporation efficiency
O₂ consumption rate10-50 nmol/min/mgContribution to cellular oxygen metabolism
H₂O₂ production rate5-25 nmol/min/mgPotential signaling or cytotoxic function

Thorough characterization of the oxidoreductase activity provides critical insights into how the enzymatic function of AIFM2 contributes to its role in apoptosis, potentially through the generation of reactive oxygen species or through specific redox-dependent protein modifications.

How does Taeniopygia guttata AIFM2 compare structurally and functionally to mammalian and other vertebrate AIFM2 homologs?

Comparative analysis of AIFM2 across species reveals significant evolutionary conservation alongside species-specific adaptations. Taeniopygia guttata (Zebra finch) AIFM2 shares fundamental structural elements with its mammalian counterparts while exhibiting distinctive features that may reflect avian-specific adaptations.

Structural Comparison:
The core structural elements of AIFM2 are largely conserved across vertebrates, with all homologs containing the characteristic Pyr_redox_2 domain essential for oxidoreductase function . This domain houses the conserved NADH- and FAD-binding motifs that support the protein's enzymatic activity. Comparative analysis indicates that Taeniopygia guttata AIFM2, like its homologs in other species, contains a putative C-terminal nuclear localization sequence (NLS) that facilitates its translocation to the nucleus during apoptosis .

One notable distinction observed in some AIFM2 homologs, including that studied in sea cucumber (Holothuria leucospilota), is the absence of an N-terminal mitochondrial localization sequence (MLS) . This feature differentiates AIFM2 from the related apoptosis-inducing factor 1 (AIF1) and may explain the primarily cytoplasmic rather than mitochondrial localization of AIFM2 under basal conditions. Detailed sequence analysis would be necessary to determine if Taeniopygia guttata AIFM2 follows this pattern or possesses distinct localization signals.

Functional Conservation:
Functionally, the apoptosis-inducing capacity of AIFM2 appears to be conserved across vertebrates. In mammals, AIFM2 has been established as a p53-responsive gene involved in apoptosis , and evidence suggests this regulatory relationship is maintained in avian species as well. The mechanism of DNA binding and subsequent chromatin condensation that leads to apoptosis appears to be a fundamental feature conserved from ancient evolutionary origins, as demonstrated by studies in echinoderm species .

The table below summarizes key comparative features of AIFM2 across species:

FeatureMammalsTaeniopygia guttata (Avian)Lower Vertebrates/Invertebrates
Pyr_redox_2 domainPresentPresentPresent
FAD/NADH binding sitesConservedConservedConserved
Nuclear localization signalPresentPresentPresent
Mitochondrial localization signalGenerally absentLikely absentOften absent (e.g., sea cucumber)
p53 responsivenessConfirmedPredicted based on conservationDemonstrated in some species (e.g., sea cucumber)
Response to heavy metalsDocumentedNot well characterizedConfirmed in echinoderms
DNA binding abilityConfirmedPredicted based on conservationConfirmed

The conservation of AIFM2 structure and function across evolutionarily distant species underscores its fundamental importance in cellular apoptotic processes. The protein appears to represent an ancient apoptotic mechanism that has been maintained throughout vertebrate evolution, with species-specific adaptations likely reflecting environmental and physiological differences.

What insights can be gained from studying AIFM2 in Taeniopygia guttata for understanding the evolution of apoptotic pathways?

Studying AIFM2 in Taeniopygia guttata offers valuable insights into the evolution of apoptotic pathways across vertebrates and provides a unique perspective on how these critical cellular mechanisms have been conserved and adapted through evolutionary time.

Evolutionary Significance of AIFM2-Mediated Apoptosis:
The caspase-independent apoptotic pathway mediated by AIFM2 represents an evolutionarily ancient mechanism of programmed cell death. Research on AIFM2 homologs in diverse species, from echinoderms to mammals, suggests that this pathway predates the divergence of these lineages . Taeniopygia guttata, as a representative of the avian lineage, occupies a critical position in vertebrate phylogeny that can illuminate both the conservation of fundamental apoptotic mechanisms and the emergence of avian-specific adaptations.

The presence of AIFM2 in species ranging from sea cucumbers to birds and mammals, with retention of core functional domains, supports the hypothesis that caspase-independent apoptosis has been under strong selective pressure throughout animal evolution . This conservation suggests that AIFM2-mediated apoptosis serves essential functions that cannot be fully compensated by other apoptotic pathways.

Comparative Genomic Insights:
Zebra finch and other avian species have undergone significant genomic reorganization compared to mammals, with zebra finch (Taeniopygia guttata) specifically having experienced substantial intra- and inter-chromosomal changes . These genomic rearrangements provide a natural experiment for examining how conserved functional pathways are maintained despite structural genomic changes. Analysis of the genomic context of AIFM2 in Taeniopygia guttata compared to mammals could reveal:

  • Conservation or divergence in regulatory elements controlling AIFM2 expression

  • Potential co-evolution with interacting partners in the apoptotic pathway

  • Adaptations in response elements (e.g., p53 binding sites) that might reflect avian-specific stress responses

Adaptations to Avian Physiology:
Birds exhibit several unique physiological traits that may have driven adaptations in apoptotic pathways:

  • Higher body temperatures compared to mammals, which may require thermostable variants of apoptotic proteins

  • Higher metabolic rates and potential for oxidative stress, which could influence the regulation and function of redox-sensitive proteins like AIFM2

  • Unique developmental patterns, particularly in neural development, where apoptosis plays a critical role

Studying the specific characteristics of Taeniopygia guttata AIFM2 may reveal adaptations that optimize its function within these distinctive physiological parameters of avian species.

Functional Diversification:
The comparative study of AIFM2 across species has already revealed intriguing functional variations. For instance, research on sea cucumber AIFM2 demonstrated significant upregulation in response to heavy metal exposure (CdCl₂), but not to pathogen-associated molecular patterns (PAMPs) . This suggests that AIFM2 may have evolved specialized responses to particular types of cellular stress in different lineages. Investigating whether Taeniopygia guttata AIFM2 shows similar stress-specific responses would provide insights into the functional diversification of this protein throughout evolution.

What are the common challenges in detecting AIFM2 translocation during apoptosis, and how can they be addressed?

Detecting AIFM2 translocation during apoptosis presents several methodological challenges that researchers must address to obtain reliable results. Based on experimental approaches used in related studies , the following challenges and solutions are recommended:

Challenge 1: Temporal Dynamics of Translocation
The translocation of AIFM2 from the cytoplasm to the nucleus during apoptosis occurs within a specific window of time that may vary depending on the apoptotic stimulus and cell type.

Solutions:

  • Implement time-course experiments with sampling at multiple time points (e.g., 1, 2, 4, 8, 12, 24 hours post-stimulation)

  • Use live-cell imaging with fluorescently tagged AIFM2 to capture the dynamic process in real-time

  • Compare multiple apoptotic stimuli to establish stimulus-specific temporal patterns

  • Consider applying computational approaches to predict optimal observation windows based on apoptotic marker expression

Challenge 2: Distinguishing AIFM2 from Related Proteins
AIFM2 shares sequence and structural similarities with other AIF family members and flavoproteins, potentially leading to cross-reactivity in detection methods.

Solutions:

  • Use highly specific antibodies validated for Taeniopygia guttata AIFM2 or cross-reactive antibodies validated against multiple species

  • Implement genetic approaches such as epitope tagging of endogenous AIFM2

  • Include appropriate controls including AIFM2 knockdown/knockout samples

  • Consider using mass spectrometry-based approaches for unambiguous protein identification

  • When using recombinant systems, design constructs with distinguishable tags or unique detection epitopes

Challenge 3: Low Endogenous Expression Levels
Endogenous AIFM2 may be expressed at relatively low levels in some cell types, making detection challenging.

Solutions:

  • Optimize protein extraction protocols with attention to subcellular fractionation efficiency

  • Use signal amplification methods such as tyramide signal amplification for immunofluorescence

  • Consider concentrating samples using immunoprecipitation before analysis

  • Select cell types or tissues known to express higher levels of AIFM2 based on transcriptomic data

  • For functional studies, consider inducible expression systems to achieve controlled expression levels

Challenge 4: Discriminating Translocation from Protein Level Changes
Changes in the nuclear/cytoplasmic ratio of AIFM2 could result from either actual translocation or compartment-specific changes in protein stability or expression.

Solutions:

  • Perform parallel measurements of total cellular AIFM2 levels alongside subcellular localization studies

  • Use protein synthesis inhibitors (e.g., cycloheximide) to distinguish translocation from new protein synthesis

  • Employ photoactivatable or photoconvertible fusion proteins to track the fate of a specific pool of AIFM2

  • Consider pulse-chase experiments with metabolic labeling to track protein movement versus turnover

Challenge 5: Confounding Factors in Apoptotic Cells
Advanced apoptosis involves cellular changes (membrane permeabilization, nuclear fragmentation) that can create artifacts in localization studies.

Solutions:

  • Carefully stage apoptosis progression using established markers (e.g., Annexin V, caspase activation)

  • Focus analyses on early apoptotic cells before membrane integrity is compromised

  • Use gentle fixation methods that preserve subcellular structures

  • Consider correlative light and electron microscopy for high-resolution localization in morphologically preserved cells

  • Include appropriate controls with apoptosis inhibitors to distinguish specific from non-specific events

The table below summarizes recommended technical approaches for studying AIFM2 translocation:

TechniqueAdvantagesLimitationsBest Applications
ImmunofluorescencePreserves cellular architecture, allows co-localization studiesFixation artifacts, antibody specificity concernsFixed timepoint analyses, co-localization with organelle markers
Live-cell imagingReal-time dynamics, single-cell analysisRequires protein tagging, potential tag interferenceTemporal dynamics, heterogeneity analysis
Subcellular fractionation + Western blotQuantitative, analysis of endogenous proteinFractionation purity concerns, lacks single-cell resolutionBiochemical confirmation, protein modification analysis
Proximity ligation assayHighly sensitive, detects protein-protein interactions in situRequires two antibodies, technical complexityInteraction studies during translocation
CRISPR-mediated endogenous taggingPhysiological expression levels, avoids overexpression artifactsTechnical challenges, limited to certain cell systemsDefinitive localization studies in appropriate model systems

By addressing these methodological challenges, researchers can obtain more reliable and meaningful data on AIFM2 translocation during apoptosis in Taeniopygia guttata and other model systems.

What quality control measures should be implemented when working with recombinant Taeniopygia guttata AIFM2?

Ensuring the quality and integrity of recombinant Taeniopygia guttata AIFM2 is critical for obtaining reliable research results. Based on the properties of AIFM2 as a flavoprotein oxidoreductase with DNA-binding capabilities , the following comprehensive quality control framework is recommended:

Comprehensive Quality Control Framework for Recombinant AIFM2:

  • Protein Identity and Purity Assessment:

    • SDS-PAGE analysis with Coomassie staining to verify molecular weight and purity

    • Western blotting with specific anti-AIFM2 antibodies for identity confirmation

    • Mass spectrometry (MS/MS) analysis for definitive sequence verification and post-translational modification mapping

    • SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to assess oligomeric state and homogeneity

  • Structural Integrity Evaluation:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content

    • Thermal shift assays to determine protein stability and proper folding

    • Limited proteolysis to assess compact folding and domain organization

    • Dynamic light scattering (DLS) to detect aggregation and assess monodispersity

  • Cofactor Association Analysis:

    • UV-visible spectroscopy (350-700 nm) to confirm FAD incorporation through characteristic flavin absorption peaks

    • Fluorescence spectroscopy to quantify flavin content (excitation at 450 nm, emission at 520 nm)

    • FAD:protein ratio determination (typically 0.8-1.0 for fully functional protein)

    • Assessment of FAD binding mode (covalent vs. non-covalent) through acid precipitation methods

  • Functional Activity Testing:

    • NADH oxidation assay measuring absorbance decrease at 340 nm

    • ROS production measurement using specific probes (e.g., Amplex Red, lucigenin)

    • DNA binding capacity assessment using electrophoretic mobility shift assay (EMSA)

    • Apoptosis induction capacity in cellular systems (e.g., nuclear condensation, cell viability)

  • Storage Stability Assessment:

    • Activity retention measurement after storage under various conditions

    • Freeze-thaw stability testing through multiple cycles

    • Long-term stability at different temperatures (-80°C, -20°C, 4°C)

    • Assessment of stabilizing buffer components (glycerol, reducing agents, salt concentration)

Quality Control Benchmarks Table:

ParameterAcceptable RangeWarning SignsRecommended Action if Outside Range
Purity by SDS-PAGE>90%Multiple bands, smearingAdditional purification steps
FAD:protein ratio0.8-1.0<0.5 indicates poor cofactor incorporationReconstitution with FAD, adjust purification protocol
A280/A450 ratio5-7 for fully FAD-bound proteinHigh ratio indicates low FAD incorporationFAD reconstitution
NADH oxidase activity>80% of reference standard<50% activityCheck for denaturation, cofactor loss
Thermal stability (Tm)Typically 50-65°C for avian proteinsSignificantly lower TmOptimize buffer conditions, check for denaturation
Oligomeric statePrimarily monomeric (may form functional dimers)High MW aggregatesOptimize storage conditions, add stabilizers
DNA bindingPositive shift in EMSA with ssDNANo DNA bindingVerify structural integrity, check pH and salt conditions
ROS productionDetectable increase above backgroundNo ROS generationVerify FAD incorporation and NADH oxidation capacity

Batch-to-Batch Consistency Measures:

To ensure reproducibility in research, implement a systematic approach to batch validation:

  • Maintain a reference standard from a well-characterized batch

  • Compare each new batch to the reference using key parameters:

    • Specific activity (activity per mg protein)

    • Electrophoretic mobility

    • Spectral characteristics

    • Thermal stability profile

  • Document all production parameters for each batch:

    • Expression conditions (temperature, induction time, media composition)

    • Purification protocol details

    • Yield and concentration

    • Date of production and stability data

  • Implement a numbering system for batches with detailed documentation of quality control results

By implementing this comprehensive quality control framework, researchers can ensure that their studies with recombinant Taeniopygia guttata AIFM2 yield reliable and reproducible results, facilitating meaningful comparisons across experiments and between research groups.

What are the emerging areas of research regarding AIFM2's role in non-apoptotic cellular processes?

While AIFM2 has been primarily characterized for its role in caspase-independent apoptosis, emerging evidence suggests it may participate in several non-apoptotic cellular processes. These potential alternative functions represent exciting frontiers for future research with Taeniopygia guttata AIFM2.

Redox Signaling and Cellular Homeostasis:
The fundamental nature of AIFM2 as a flavoprotein oxidoreductase with NADH- and FAD-binding domains positions it as a potential contributor to cellular redox homeostasis. Future research should explore:

  • AIFM2's potential role in maintaining NAD+/NADH ratios under normal physiological conditions

  • Contribution to cellular defense against oxidative stress through regulated ROS production

  • Participation in redox-sensitive signaling pathways independent of its apoptotic function

  • Possible involvement in metabolic regulation through interaction with energy-sensing pathways

DNA Damage Response Beyond Apoptosis:
The ability of AIFM2 to bind single-stranded DNA suggests it might participate in DNA damage response pathways in roles separate from executing cell death. Research directions could include:

  • Investigation of AIFM2's potential role in DNA damage detection or signaling

  • Possible participation in DNA repair mechanisms, particularly for single-strand damage

  • Interaction with other DNA damage response proteins independent of apoptotic signaling

  • Contribution to genomic stability maintenance under sublethal stress conditions

Developmental Processes:
The regulation of AIFM2 by p53 and evidence from sea cucumber studies showing increased expression during larval development suggest potential developmental roles. Future investigations should address:

  • Temporal and spatial expression patterns of AIFM2 during Taeniopygia guttata embryonic development

  • Potential functions in tissue remodeling and developmental apoptosis

  • Role in neuronal development and differentiation

  • Contribution to developmental processes requiring controlled redox signaling

Stress Response Integration:
The differential response of AIFM2 to various stressors, such as heavy metals versus pathogen-associated molecular patterns , suggests it may function as a stress-specific response integrator. Future research could explore:

  • The full spectrum of stressors that specifically regulate AIFM2 expression or activity

  • Molecular mechanisms underlying stress-specific responses

  • Integration of AIFM2 function with other stress response pathways

  • Evolutionary adaptations in stress response pathways involving AIFM2 across species

Interaction with Mitochondrial Function:
Despite potentially lacking a mitochondrial localization sequence , AIFM2's classification as a mitochondrion-associated factor warrants investigation of its relationship with mitochondrial biology:

  • Potential regulation of mitochondrial redox state or metabolic activity

  • Interaction with mitochondrial proteins under normal and stress conditions

  • Influence on mitochondrial dynamics (fission/fusion) independent of apoptosis

  • Role in mitochondrial quality control mechanisms

The table below summarizes potential non-apoptotic functions of AIFM2 and corresponding experimental approaches:

Potential FunctionSupporting EvidenceRecommended Experimental Approaches
Redox homeostasis regulatorOxidoreductase activity, FAD/NADH binding domains Metabolomic analysis of NAD+/NADH ratios in AIFM2-modulated cells; ROS measurements under normal conditions
DNA damage response modulatorssDNA binding capability Comet assay with AIFM2 knockdown/overexpression; Immunoprecipitation with DNA repair proteins
Developmental regulatorIncreased expression during larval development (in sea cucumber) Developmental transcriptomics in Taeniopygia guttata; AIFM2 knockdown effects on embryonic development
Stress-specific signaling integratorDifferential response to various stressors Phosphoproteomics under various stress conditions with AIFM2 modulation; Stress-specific interactome studies
Mitochondrial function modulatorMitochondrion-associated classification Mitochondrial respiratory analysis; Mitochondrial morphology assessment with AIFM2 modulation

These emerging research directions represent exciting opportunities to expand our understanding of AIFM2 beyond its canonical apoptotic role, potentially revealing new functions that contribute to cellular homeostasis and stress adaptation across species.

How might the study of AIFM2 in Taeniopygia guttata contribute to therapeutic applications in human diseases?

The study of AIFM2 in Taeniopygia guttata holds substantial translational potential for human disease applications, particularly in the contexts of cancer, neurodegenerative disorders, and stress-related pathologies. The evolutionary conservation of AIFM2's structure and function across species provides a foundation for comparative studies that could illuminate novel therapeutic approaches.

Cancer Therapeutics and Diagnostics:
The connection between AIFM2 and p53-mediated apoptosis positions this protein as a potential target in cancer therapeutics, particularly for developing strategies that circumvent resistance to conventional apoptotic pathways.

  • Alternative Apoptotic Pathways:
    The caspase-independent apoptotic mechanism mediated by AIFM2 represents a potential alternative pathway for eliminating cancer cells that have developed resistance to conventional apoptotic triggers. Similar to the development of proapoptotic receptor agonists like rhApo2L/TRAIL , understanding AIFM2's activation mechanisms could lead to novel therapeutic approaches that specifically target this pathway.

  • Biomarker Potential:
    Comparative studies between human and Taeniopygia guttata AIFM2 could identify conserved regulatory mechanisms and post-translational modifications that might serve as biomarkers for cancer progression or treatment response. The p53-responsive nature of AIFM2 suggests it could be particularly relevant in tumors with varying p53 status.

  • Selective Targeting Strategies:
    The oxidoreductase activity of AIFM2 and its role in ROS production could be exploited to develop cancer-selective therapies that leverage the altered redox state common in many cancer cells. Comparative studies across species could identify conserved structural elements critical for this function that could be targeted pharmacologically.

Neurodegenerative Disease Applications:
The role of AIFM2 in caspase-independent cell death pathways has implications for neurodegenerative disorders where inappropriate apoptosis contributes to pathology.

  • Neuroprotective Strategies:
    Understanding the regulation and activation of AIFM2 in neuronal contexts could lead to neuroprotective approaches that inhibit inappropriate activation of this apoptotic pathway. Avian models, with their unique neuronal adaptations, could provide insights into endogenous protective mechanisms.

  • Oxidative Stress Modulation:
    The oxidoreductase activity of AIFM2 positions it at the intersection of redox signaling and cell death, a critical nexus in neurodegenerative pathologies. Comparative studies could identify species-specific adaptations that modulate this activity, potentially inspiring therapeutic approaches to mitigate oxidative damage.

Environmental Health and Toxicology:
The demonstrated response of AIFM2 to heavy metal exposure in some species suggests applications in environmental health and toxicology.

  • Biomarker for Environmental Exposure:
    The upregulation of AIFM2 in response to cadmium suggests it could serve as a biomarker for heavy metal exposure. Comparative studies across species could identify conserved response elements that might be applicable to human environmental health monitoring.

  • Cellular Protection Mechanisms:
    Understanding how different species regulate AIFM2 in response to environmental stressors could reveal protective mechanisms that might be exploited therapeutically to enhance human cellular resilience to similar exposures.

Translational Research Framework:

The table below outlines a framework for translating findings from Taeniopygia guttata AIFM2 research to human therapeutic applications:

Research AreaComparative ApproachTranslational PotentialTechnological Platform
Structure-function analysisStructural comparison between avian and human AIFM2Identification of conserved functional domains for drug targetingCryo-EM, X-ray crystallography, molecular dynamics simulations
Regulation mechanismsComparative analysis of p53 response elements and other regulatory regionsDesign of synthetic promoters or gene therapy approachesCRISPR screening, comparative genomics, reporter assays
Stress-response pathwaysCross-species comparison of AIFM2 activation by various stressorsDevelopment of stress-specific interventionsMulti-omics approaches, systems biology modeling
Protein interaction networksIdentification of conserved vs. species-specific interaction partnersDiscovery of critical nodes for therapeutic targetingInteractome analysis, protein-protein interaction screening
Gene-environment interactionsComparative analysis of environmental responses across speciesEnvironmental risk assessment and preventive strategiesExposome analysis, epigenetic profiling

Ultimately, the study of AIFM2 in Taeniopygia guttata provides a valuable comparative model that can illuminate evolutionary conserved mechanisms of programmed cell death and stress response. These insights can guide the development of novel therapeutic approaches that might be less susceptible to resistance mechanisms or offer alternative treatment modalities for conditions where conventional approaches have limited efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.