Recombinant Taeniopygia guttata Cannabinoid receptor 1 (CNR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Taeniopygia guttata Cannabinoid receptor 1

Taeniopygia guttata, commonly known as the zebra finch, represents a pivotal model organism in neurobiology research due to its unique vocal learning capabilities. These songbirds learn their vocal behaviors during specific developmental sensitive periods, mirroring the way human language acquisition occurs . This characteristic makes them particularly valuable for studying the neurobiological mechanisms underlying learning and memory. Cannabinoid receptor 1 (CNR1) in zebra finches has emerged as a significant focus of research due to its expression in brain regions known to control both juvenile song learning and adult song production .

The cannabinoid receptor system plays crucial roles in numerous physiological processes across vertebrate species. In zebra finches, CNR1 (also designated as CB1 or CB-R) represents the central cannabinoid receptor expressed in the brain . This G-protein coupled receptor mediates the effects of both endogenous cannabinoids and exogenous cannabinoid compounds, participating in signaling pathways that influence neurodevelopment, cellular morphology, and behavioral outputs. The recombinant form of Taeniopygia guttata CNR1 provides researchers with a purified protein resource for investigating the structure, pharmacology, and function of this important neurobiological component.

Cannabinoid signaling in zebra finches has garnered particular attention because pharmacological manipulation of CNR1 activity demonstrably alters vocal learning processes . As studies have shown, late postnatal exposure to cannabinoid agonists impacts zebra finch song learning, suggesting that CNR1 plays a regulatory role in the critical developmental stages of vocal acquisition . These observations highlight the importance of understanding the molecular properties and functional roles of zebra finch CNR1 in both basic neuroscience and comparative neurobiological research.

Molecular Structure and Properties

Taeniopygia guttata Cannabinoid receptor 1 is encoded by the CNR1 gene, which is also referred to by the aliases CB1 and CB-R in the scientific literature . The molecular characterization of zebra finch CNR1 (ZFCB1) has revealed striking homology with mammalian counterparts. Specifically, the amino acid sequence of ZFCB1 demonstrates 92% identity with the human CB1 receptor, indicating strong evolutionary conservation of this signaling component across vertebrate species . This high degree of sequence conservation suggests functional similarity, which has been confirmed through pharmacological and signal transduction studies.

The recombinant form of Taeniopygia guttata CNR1 is typically produced using various expression systems, including E. coli, yeast, baculovirus, or mammalian cell cultures . The protein obtained from these expression systems generally achieves a purity level of 85% or greater, as determined by SDS-PAGE analysis . This level of purity makes the recombinant protein suitable for a wide range of experimental applications, including structural studies, binding assays, and functional characterization.

Table 1: Properties of Recombinant Taeniopygia guttata CNR1

PropertyDescription
Gene NamesCNR1, CB1, CB-R
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cell
Protein Purity≥85% (SDS-PAGE)
Amino Acid Identity to Human CB192%
Molecular Weight~63 kDa (estimated based on mammalian CB1)

When expressed in cellular systems, zebra finch CB1 receptors successfully traffic to plasma membranes and, notably, to filopodia in filopodia-expressing cells . Immunocytochemistry studies have revealed that ZFCB1 exhibits a distinctive pattern of expression, with clustered aggregations of receptor protein that appear particularly pronounced in filopodia . This distribution pattern suggests specialized roles for CNR1 in cellular processes related to morphological development and plasticity, which may be relevant to its functions in neural circuit formation during vocal learning.

Expression Patterns in the Zebra Finch Brain

The developmental expression pattern of CNR1 in the zebra finch brain has been characterized through immunohistochemical studies using affinity-purified polyclonal antibodies directed against the zebra finch CB1 cannabinoid receptor . These investigations have revealed dynamic changes in CNR1 expression across different developmental stages, with observations in male zebra finches at 25, 50, 75, and over 100 days of age (adults). A general pattern of waxing and waning staining intensity has been documented throughout this developmental period, suggesting age-dependent regulation of CNR1 expression that may correlate with different phases of vocal learning and production .

Particularly noteworthy is the distinct staining pattern observed in song-related brain regions, which provides insights into the potential roles of CNR1 in vocal learning and production. Early establishment of CNR1 expression within rostral telencephalic song regions, specifically area X and the lateral magnocellular nucleus of the anterior nidopallium (lMAN), suggests a role for cannabinoid signaling in auditory learning processes . These brain regions are known to be involved in the sensory phase of song learning, during which young zebra finches memorize the songs of adult tutors.

Later in development, CNR1 expression becomes established and maintained in adulthood within other regions of the rostral telencephalon, particularly HVC (formerly known as the high vocal center) and the robust nucleus of the arcopallium (RA) . This pattern is consistent with a role for cannabinoid signaling in vocal motor functions, as these brain regions are critical components of the motor pathway for song production. The maintenance of CNR1 expression in these regions throughout adulthood suggests ongoing roles in the refinement and execution of learned vocalizations.

Table 2: Developmental Expression of CNR1 in Zebra Finch Brain Regions

Brain RegionFunctionExpression Pattern
Area XAuditory learningEarly establishment
lMANAuditory learningEarly establishment
HVCVocal motorLater establishment, maintained in adulthood
RAVocal motorLater establishment, maintained in adulthood

At the cellular level, CNR1 staining has been observed in both small somata and neuropil within these song-related brain regions . This distribution pattern indicates that cannabinoid signaling may influence both cellular and network properties within the song system. The developmental trajectory of CNR1 expression aligns with the critical periods for song learning in zebra finches, providing further evidence for its involvement in the acquisition and production of this complex learned behavior.

Pharmacological Properties

The pharmacological characterization of zebra finch CNR1 has been conducted through radioligand binding assays investigating the affinity profiles of various cannabinoid ligands representing different structural classes . These studies have established that ZFCB1 exhibits binding properties comparable to those of mammalian CB1 receptors, further supporting the functional conservation of this receptor across vertebrate species. The established affinity profile provides a valuable reference for comparing cannabinoid pharmacology across different experimental models.

Signal transduction mechanisms mediated by ZFCB1 have been investigated using stably transfected cell lines. In a Chinese hamster ovary (CHO) cell line expressing ZFCB1, the cannabinoid agonist WIN55212-2 demonstrated dose-dependent and potent inhibition of forskolin-stimulated adenylate cyclase activity . Specifically, WIN55212-2 exhibited an IC50 of 9.0 nM and achieved maximum inhibition of 49% at a concentration of 100 nM, effects that were reversed by 1 mM of the CB1 antagonist SR141716A . This inhibition of adenylate cyclase activity indicates that ZFCB1-mediated signal transduction mechanisms align with those observed for mammalian CB1 receptors, which typically couple to Gi/o proteins to inhibit cAMP production.

Table 3: Pharmacological Properties of Zebra Finch CNR1

PropertyValue/Observation
WIN55212-2 (Agonist) IC50 for Adenylate Cyclase Inhibition9.0 nM
Maximum Inhibition by WIN55212-2 (100 nM)49%
Antagonist ReversalSR141716A (1 mM)
Low Dose WIN55212-2 Effect on FilopodiaIncreased length (3 nM)
High Dose WIN55212-2 Effect on FilopodiaDecreased length (30-100 nM)
SR141716A Effect on FilopodiaIncreased length and number (30-100 nM)

Interestingly, activation of zebra finch CB1 receptors produces dose-dependent biphasic effects on cellular morphology. When expressed in CHO cells, activation of ZFCB1 with low concentrations of WIN55212-2 (3 nM) increases the mean length of filopodia, while higher concentrations (30 and 100 nM) reduce filopodia length . Conversely, treatment with the antagonist/inverse agonist SR141716A at concentrations of 30 and 100 nM causes increases in both mean filopodia length and number . These observations demonstrate that cannabinoid receptor activation can differentially influence cellular morphology depending on the concentration of ligand, suggesting complex dose-dependent signaling mechanisms.

Functional Roles in Vocal Learning and Production

The functional significance of CNR1 in zebra finch vocal behavior has been demonstrated through pharmacological manipulation studies. Administration of the cannabinoid agonist WIN55212-2 inhibits adult song production and locomotor activity in zebra finches, effects that can be reversed by cannabinoid antagonists . These behavioral outcomes indicate that cannabinoid signaling directly influences the execution of learned vocalizations, potentially through modulation of neural activity within the song motor pathway.

Beyond its effects on adult song production, cannabinoid signaling appears to play crucial roles in the developmental processes underlying song learning. Late postnatal exposure to cannabinoid agonists has been shown to alter zebra finch song learning, suggesting that proper regulation of CNR1 activity is necessary for normal vocal development . The temporal correlation between CNR1 expression patterns in song-related brain regions and the critical periods for song learning provides further evidence for its involvement in this complex learning process.

At the cellular level, CNR1 activation may influence vocal learning and production through regulation of neuronal morphology and connectivity. The effects of cannabinoid receptor activation on filopodia length and number suggest potential roles in modulating neuronal outgrowth, synaptogenesis, and circuit formation . Recent findings indicate that cannabinoid-altered vocal development involves elevated densities of dendritic spines in specific brain regions involved in zebra finch song learning and production, further supporting a role for CNR1 in regulating cellular structure .

The biphasic effects of CNR1 activation on filopodia morphology may reflect differential coupling with cellular effectors, resulting in distinct signaling outcomes at different agonist concentrations . This complex dose-dependent signaling could allow for fine-tuned regulation of neuronal development and plasticity during different phases of vocal learning. The distinct patterns of CNR1 expression in auditory learning regions (area X, lMAN) versus vocal motor regions (HVC, RA) further suggest specialized roles in different aspects of song acquisition and production .

Research Applications and Future Directions

The recombinant form of Taeniopygia guttata CNR1 represents a valuable tool for investigating cannabinoid signaling in the context of vocal learning and production. Its high degree of amino acid sequence identity with human CB1 receptor (92%) makes zebra finch an excellent comparative model for studying cannabinoid effects on learning processes with potential relevance to human language acquisition . The conserved pharmacology and signal transduction mechanisms of ZFCB1 further enhance its utility as a model system for cannabinoid research.

Researchers can utilize recombinant Taeniopygia guttata CNR1 for various experimental applications, including binding assays to characterize novel cannabinoid ligands, structure-function studies to identify critical domains for receptor activation and signaling, and in vitro cellular assays to investigate downstream signaling pathways. The availability of recombinant CNR1 with high purity (≥85%) facilitates these investigations by providing a reliable source of the target protein .

The zebra finch model, with its well-characterized song learning system and established role for CNR1 in vocal behavior, offers unique opportunities for investigating the effects of cannabinoids on learning and memory processes. Future research directions might include more detailed characterization of the molecular mechanisms by which CNR1 activation influences neuronal morphology and connectivity within song-related brain regions. Additionally, longitudinal studies examining the long-term consequences of cannabinoid exposure during critical developmental periods could provide insights into the lasting effects of perturbed cannabinoid signaling on learned behaviors.

Genetic and molecular approaches, such as CRISPR-Cas9 gene editing or viral-mediated expression of mutant receptors, could be employed to further elucidate the specific roles of different CNR1 domains and signaling pathways in vocal learning and production. Comparative studies examining CNR1 structure, expression, and function across different species with varying vocal learning capabilities might also yield insights into the evolutionary significance of cannabinoid signaling in the development of complex communicative behaviors.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please specify your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance for arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
CNR1; Cannabinoid receptor 1; CB-R; CB1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-473
Protein Length
full length protein
Species
Taeniopygia guttata (Zebra finch) (Poephila guttata)
Target Names
Target Protein Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDMKGDMASKLGYYPQKFPLSSFRGDPFQE KMTGGDDSLLSIIPSEQVNITEFYNKSLSTFKDNEENIQCGENFMDMECFMILNPSQQLA IAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFH VFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFC VMWTIAIVIAVLPLLGWNCKKLNSVCSDIFPLIDETYLMFWIGVTSILLLFIVYAYMYIL WKAHSHAVRMLQRGTQKSIIIQSTEDGKVQITRPDQTRMDIRLAKTLVLILVVLIICWGP LLAIMVYDVFGKMNKLIKTIFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPTCEGT AQPLDNSMESDCQHKHANNAGNVHRAAESCIKSTVKIAKVTMSVSTDTTAEAL
Uniprot No.

Target Background

Function
The cannabinoid receptor 1 (CNR1) is a G-protein coupled receptor that binds to cannabinoids, including endocannabinoids (eCBs) such as N-arachidonoylethanolamide (anandamide or AEA) and 2-arachidonoylglycerol (2-AG). It mediates a wide range of cannabinoid-induced effects, including: * Regulation of food intake * Memory loss * Gastrointestinal motility * Catalepsy * Ambulatory activity * Anxiety * Chronic pain Signal transduction through CNR1 typically involves a decrease in cyclic AMP levels. In the hypothalamus, CNR1 can exhibit a dual effect on mitochondrial respiration, depending on the agonist dose and potentially the cell type. At low doses, CNR1 increases respiration, while at high doses, it decreases respiration. At high doses, CNR1 signal transduction involves activation of G-protein alpha-i proteins, subsequent inhibition of mitochondrial soluble adenylate cyclase, decreased cyclic AMP concentration, and inhibition of protein kinase A (PKA)-dependent phosphorylation of specific subunits within the mitochondrial electron transport system, including NDUFS2. In the hypothalamus, CNR1 inhibits leptin-induced reactive oxygen species (ROS) formation and mediates cannabinoid-induced increases in SREBF1 and FASN gene expression. In response to cannabinoids, CNR1 promotes the release of orexigenic beta-endorphin, but not melanocyte-stimulating hormone alpha/alpha-MSH, from hypothalamic POMC neurons, leading to increased food intake. Within the hippocampus, CNR1 regulates cellular respiration and energy production in response to cannabinoids. It is involved in cannabinoid-dependent depolarization-induced suppression of inhibition (DSI), a process in which depolarization of CA1 postsynaptic pyramidal neurons mobilizes eCBs, which retrogradely activate presynaptic CB1 receptors, transiently decreasing GABAergic inhibitory neurotransmission. CNR1 also reduces excitatory synaptic transmission. In superior cervical ganglions and cerebral vascular smooth muscle cells, CNR1 inhibits voltage-gated Ca(2+) channels in a constitutive, as well as agonist-dependent manner. CNR1 induces leptin production in adipocytes and reduces LRP2-mediated leptin clearance in the kidney, contributing to hyperleptinemia. In adipose tissue, CNR1 signaling leads to increased expression of SREBF1, ACACA, and FASN genes. In the liver, activation by cannabinoids results in increased de novo lipogenesis and reduced fatty acid catabolism, associated with increased expression of SREBF1/SREBP-1, GCK, ACACA, ACACB, and FASN genes. CNR1 may also influence de novo cholesterol synthesis and HDL-cholesteryl ether uptake. Peripherally, CNR1 modulates energy metabolism. In high carbohydrate diet-induced obesity, CNR1 may decrease the expression of mitochondrial dihydrolipoyl dehydrogenase/DLD in striated muscles, as well as that of selected glucose/ pyruvate metabolic enzymes, thus affecting energy expenditure through mitochondrial metabolism. In response to the cannabinoid anandamide, CNR1 elicits a proinflammatory response in macrophages, which involves NLRP3 inflammasome activation and IL1B and IL18 secretion.
Gene References Into Functions
  1. An altered expression of cannabinoid receptor 1 in brain regions is responsible for vocal learning. PMID: 21211022
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Mitochondrion outer membrane. Cell projection, axon. Cell junction, synapse, presynapse.

Q&A

What is Taeniopygia guttata Cannabinoid Receptor 1 (CNR1)?

Taeniopygia guttata Cannabinoid Receptor 1 (ZFCB1) is the zebra finch ortholog of the cannabinoid receptor 1, a G-protein coupled receptor that mediates cannabinoid signaling in the central nervous system of birds. The receptor is highly expressed in brain regions associated with song learning and production in zebra finches. ZFCB1 shares approximately 92% amino acid sequence identity with the human CB1 receptor, indicating a high degree of evolutionary conservation across vertebrate species . This conservation suggests that fundamental signaling mechanisms have been preserved, though species-specific differences may exist in terms of distribution and functional properties.

How can ZFCB1 be recombinantly expressed for research purposes?

Methodological approach for recombinant expression:

  • Clone the full-length ZFCB1 cDNA into an appropriate expression vector containing a strong promoter (e.g., CMV) and selection marker.

  • Transfect the expression vector into a mammalian cell line such as Chinese Hamster Ovary (CHO) cells using lipofection, electroporation, or other transfection methods.

  • Select stable transfectants using appropriate antibiotics based on the selection marker in the expression vector.

  • Validate ZFCB1 expression through Western blotting, immunocytochemistry, or functional assays.

  • Maintain stable cell lines under continuous selection pressure to prevent loss of expression.

Chinese Hamster Ovary (CHO) cells have been successfully used as an expression system for ZFCB1, allowing for the characterization of receptor pharmacology and signaling properties . The establishment of such cell lines provides a valuable tool for studying the molecular and cellular functions of ZFCB1 in a controlled environment.

What are the basic signaling mechanisms of ZFCB1?

ZFCB1 primarily signals through inhibitory G-proteins (Gi/o) that modulate adenylate cyclase activity. Upon activation by cannabinoid agonists like WIN55212-2, ZFCB1 potently inhibits forskolin-stimulated adenylate cyclase activity with an IC50 of approximately 9.0 nM . At a concentration of 100 nM, WIN55212-2 produces a maximum inhibition of about 49% of forskolin-stimulated adenylate cyclase activity, an effect that can be reversed by the selective CB1 antagonist SR141716A at 1 mM concentration .

This inhibition of adenylate cyclase reduces intracellular cAMP levels, affecting numerous downstream signaling cascades. Additionally, ZFCB1 activation may influence other signaling pathways, including regulation of ion channels and activation of mitogen-activated protein kinases, similar to mammalian CB1 receptors. The signaling mechanism of ZFCB1 is consistent with that observed for mammalian CB1 receptors, suggesting evolutionary conservation of cannabinoid receptor function across vertebrate species.

What regulatory considerations apply to recombinant ZFCB1 research?

Research involving recombinant ZFCB1 must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules if conducted at institutions receiving NIH funding or if materials developed with NIH funds are used in human testing . According to these guidelines, recombinant nucleic acids are defined as "molecules that are constructed by joining nucleic acid molecules and that can replicate in a living cell" .

Key regulatory requirements include:

  • Institutional Biosafety Committee (IBC) approval for experiments

  • Appropriate containment practices and facilities

  • Risk assessment of the recombinant construct

  • Proper documentation and reporting of research activities

For international collaborations, research must comply with host country regulations or, in the absence of such regulations, be reviewed and approved by an NIH-approved IBC and accepted by national governmental authorities of the host country .

How does ZFCB1 influence neuronal morphology and cytoskeletal dynamics?

ZFCB1 activation produces significant effects on neuronal morphology through cytoskeletal modulation. In CHO cells heterologously expressing ZFCB1, cannabinoid agonists produce dose-dependent biphasic effects on filopodia length . At low concentrations (approximately 3 nM WIN55212-2), filopodia length increases, while higher concentrations reduce filopodia length . These effects suggest that ZFCB1 activation modulates actin cytoskeleton dynamics in a concentration-dependent manner.

The effects on cytoskeletal dynamics may involve multiple signaling pathways:

  • Regulation of small GTPases like Rac1 that control actin polymerization

  • Modulation of actin-binding proteins that affect filament stability

  • Interaction with scaffolding proteins that organize cytoskeletal elements

These cytoskeletal effects are particularly relevant in neurons, where they may influence dendritic spine formation, growth cone dynamics, and ultimately neural connectivity. Research suggests that cannabinoids can affect vocal development in zebra finches through altered dendritic spine densities in brain regions involved in song learning and production .

What methodological approaches are optimal for studying ZFCB1 pharmacology?

MethodApplicationAdvantagesLimitations
Radioligand binding assaysReceptor affinity profilingPrecise quantification of binding kineticsLimited functional information
cAMP inhibition assaysG-protein signalingDirect measure of primary signaling pathwayMisses other signaling modes
GTPγS bindingG-protein activationMeasures early signaling eventsTechnical complexity
Ca²⁺ imagingSecondary messenger responsesReal-time cellular responsesIndirect measure for Gi-coupled receptors
β-arrestin recruitmentReceptor desensitizationIdentifies biased ligandsRequires specialized reporters

For comprehensive pharmacological characterization of ZFCB1, multiple complementary approaches should be employed. Radioligand binding assays establish affinity profiles for cannabinoid ligands representing different structural classes . Functional assays measuring inhibition of forskolin-stimulated adenylate cyclase activity provide information about signaling efficacy . The combination of binding and functional assays allows researchers to distinguish between ligand affinity and efficacy, identifying potential biased agonists that may selectively activate specific signaling pathways.

When testing novel compounds, a concentration range of at least 6 points (typically 0.1 nM to 10 μM) should be used to generate complete dose-response curves for accurate determination of potency (EC50/IC50) and efficacy parameters.

How can researchers differentiate between direct and indirect effects of ZFCB1 activation?

Differentiating between direct and indirect effects of ZFCB1 activation requires systematic experimental approaches:

  • Temporal analysis: Monitor signaling events with high temporal resolution to establish sequential activation patterns. Primary (direct) effects typically occur within seconds to minutes, while secondary effects develop over longer timeframes.

  • Pathway inhibitors: Use selective inhibitors targeting specific downstream pathways. For instance, if a ZFCB1-mediated effect persists despite inhibition of adenylate cyclase, it suggests involvement of alternative signaling pathways.

  • Mutational analysis: Generate ZFCB1 mutants with altered coupling to specific G-proteins or signaling molecules. Comparing effects of wild-type and mutant receptors can reveal pathway-specific contributions.

  • Reconstitution experiments: In cell-free systems, reconstitute ZFCB1 with purified signaling components to directly observe receptor-effector interactions without cellular complexity.

  • Biased ligands: Employ ligands that selectively activate specific signaling pathways (e.g., G-protein vs. β-arrestin) to dissect pathway-specific effects.

When studying ZFCB1 effects on cytoskeletal dynamics, these approaches can help determine whether effects on filopodia length result directly from ZFCB1-mediated signaling or indirectly through intermediate cellular processes .

What approaches are recommended for analyzing ZFCB1's role in vocal learning?

Studying ZFCB1's role in zebra finch vocal learning requires integrative approaches spanning molecular, cellular, and behavioral levels:

  • Temporal expression analysis: Characterize ZFCB1 expression across developmental stages critical for song learning using qPCR, in situ hybridization, and immunohistochemistry.

  • Region-specific manipulation: Use viral vectors for localized knockdown or overexpression of ZFCB1 in specific song-related brain regions (Area X, HVC, RA).

  • Pharmacological intervention: Administer CB1 agonists/antagonists at specific developmental timepoints to assess effects on song acquisition and production. Previous studies have shown that cannabinoid agonist WIN55212-2 inhibits adult song production, an effect reversed by antagonists .

  • Electrophysiological recordings: Measure neuronal activity in song-control nuclei during cannabinoid administration to characterize circuit-level effects.

  • Dendritic spine analysis: Quantify changes in spine morphology and density in song-control neurons following ZFCB1 manipulation, as cannabinoids alter dendritic spine densities in brain regions involved in vocal learning .

  • Behavioral analysis: Employ sophisticated song analysis software to quantify subtle changes in acoustic features, syntax, and performance following ZFCB1 manipulation.

These approaches should be integrated within longitudinal experimental designs that track both neurobiological and behavioral changes throughout the critical period for song learning.

What are the key considerations for ZFCB1 heterologous expression systems?

When establishing heterologous expression systems for ZFCB1 research, several critical factors must be considered:

  • Expression vector selection: Choose vectors with promoters optimized for the host cell line. CMV promoters work well in mammalian cells like CHO, while insect cell expression may require different promoters.

  • Codon optimization: Consider codon usage bias in the expression host. Codon-optimized ZFCB1 sequences can significantly improve expression levels.

  • Post-translational modifications: Ensure the expression system supports appropriate receptor glycosylation and phosphorylation, which may affect trafficking and function.

  • Expression validation: Confirm functional expression through multiple methods:

    • Binding assays with radiolabeled cannabinoids

    • Western blot analysis for protein expression

    • Functional assays measuring adenylate cyclase inhibition

    • Subcellular localization using fluorescent tags or immunostaining

  • Control experiments: Include parallel experiments with known CB1 ligands as positive controls and establish proper negative controls (untransfected cells, inactive ligands).

  • Stability considerations: Monitor expression stability over multiple passages and consider inducible expression systems for receptors that might affect cell viability.

CHO cells have been successfully used to express functional ZFCB1, demonstrating that the receptor can inhibit forskolin-stimulated adenylate cyclase activity in response to WIN55212-2 with an IC50 of 9.0 nM . The established pharmacological profile in this system provides a valuable benchmark for future studies using heterologous expression of ZFCB1.

How can ZFCB1 research contribute to understanding cannabinoid effects on learning?

ZFCB1 research offers unique insights into cannabinoid modulation of learning processes for several reasons:

  • Specialized learning model: Zebra finches represent a specialized model for studying vocal learning, which shares similarities with human speech acquisition. ZFCB1 is expressed in brain regions known to control both juvenile song learning and adult recitation of song .

  • Developmental windows: Zebra finches learn vocal behavior during discrete sensitive developmental periods, similar to critical periods in human language acquisition . This allows precise temporal manipulation of cannabinoid signaling during defined learning phases.

  • Quantifiable outcomes: Song structure provides objectively quantifiable learning outcomes that can be measured following cannabinoid system manipulation.

  • Neural circuit specificity: The well-characterized song control system allows researchers to investigate cannabinoid effects on specific neural circuits with known functions.

Cannabinoid modulation of songbird vocal learning may involve cytoskeletal reorganization, as activation of ZFCB1 affects dendritic spine density in song-relevant brain regions and influences filopodia morphology . These structural changes likely impact synaptic plasticity mechanisms underlying learning. The zebra finch model thus provides a promising system to investigate how cannabinoids affect learning by juvenile birds, with potential implications for understanding cannabinoid effects on learning processes across species .

What are the comparative aspects of ZFCB1 versus mammalian CB1 receptors?

FeatureZFCB1Mammalian CB1
Amino acid identityReference92% identical to ZFCB1
Primary signalingGi/o-mediated adenylate cyclase inhibitionGi/o-mediated adenylate cyclase inhibition
Expression patternEnriched in song control nucleiHighest levels in basal ganglia, cerebellum, hippocampus
Functional roleModulates song learning and productionRegulates mood, memory, appetite, pain sensation
Pharmacological profileWIN55212-2 potently inhibits adenylate cyclase (IC50 = 9.0 nM) Similar affinity for WIN55212-2
Signaling efficiency49% maximum inhibition of adenylate cyclase at 100 nM WIN55212-2 Up to 80% inhibition depending on tissue/cell type

Despite high sequence homology (92% identity), subtle differences in receptor structure may lead to species-specific pharmacological responses or signaling biases. Comparative studies examining these differences could reveal evolutionary adaptations in cannabinoid signaling across vertebrate lineages and identify receptor domains critical for specific functions. Additionally, the distinct neuroanatomical distribution of ZFCB1 in songbird brains compared to mammalian CB1 distribution may reflect specialized roles in avian-specific behaviors such as song learning and production .

How does ZFCB1 activation modulate neuronal morphology at the molecular level?

ZFCB1 activation produces complex effects on neuronal morphology through multiple molecular pathways:

  • Cytoskeletal regulation: ZFCB1 activation modulates actin polymerization and stability, producing biphasic effects on filopodia length depending on agonist concentration . This suggests concentration-dependent activation of different downstream pathways.

  • Growth cone dynamics: In developing neurons, ZFCB1 activation affects growth cone stability, potentially influencing axonal guidance and target innervation during development.

  • Dendritic spine modulation: Cannabinoid agonists acting through ZFCB1 attenuate activity-dependent remodeling of dendritic spines in neurons, affecting synaptic plasticity .

  • WAVE1 complex interaction: While not directly demonstrated for ZFCB1, mammalian CB1 receptors assemble with members of the WAVE1 complex and RhoGTPase Rac1, modulating their activity . Given the high sequence homology, ZFCB1 likely engages similar pathways.

The effects on neuronal morphology appear to involve concentration-dependent activation of different signaling cascades. At low agonist concentrations (3 nM WIN55212-2), ZFCB1 activation increases filopodia length, while higher concentrations reduce filopodia length . This biphasic response suggests that ZFCB1 may differentially couple to distinct signaling pathways depending on activation state, potentially through different G-protein subtypes or β-arrestin recruitment.

What are common challenges in ZFCB1 recombinant expression and how can they be addressed?

ChallengePotential CausesSolutions
Low expression levelsInefficient transcription, translation, or protein degradation- Optimize codon usage for expression host
- Try different promoters
- Include protease inhibitors
- Test different cell lines
Poor membrane localizationImproper folding, retention in ER- Include molecular chaperones
- Add N-terminal signal sequences
- Optimize growth temperature
- Try different tags or tag positions
Low functional activityImproper glycosylation, absence of interacting proteins- Use mammalian expression systems
- Co-express relevant G-proteins
- Optimize detergent conditions for solubilization
Expression toxicityConstitutive activity affecting cell viability- Use inducible expression systems
- Reduce expression levels
- Co-express with inverse agonists

When troubleshooting ZFCB1 expression, it's critical to validate not only protein expression but also functional activity through assays such as adenylate cyclase inhibition. The established CHO cell system for ZFCB1 has demonstrated successful expression with functional coupling to adenylate cyclase inhibition , providing a benchmark for optimizing expression in other systems.

How should researchers design experiments to capture biphasic effects of ZFCB1 activation?

Biphasic effects of ZFCB1 activation, such as those observed on filopodia length , require careful experimental design:

  • Comprehensive concentration range: Use a wide concentration range (preferably 10⁻¹⁰ to 10⁻⁵ M) with multiple intermediate points to capture both stimulatory and inhibitory phases of the response.

  • Time-course analysis: Measure responses at multiple time points (minutes to hours) to distinguish between rapid signaling events and delayed adaptive responses.

  • Single-cell approaches: Employ single-cell imaging or analysis when possible to detect cell-to-cell variability in responses that might be masked in population-based assays.

  • Pathway dissection: Use selective inhibitors of downstream signaling components to identify pathways mediating each phase of the biphasic response:

    • PKA inhibitors (e.g., H89)

    • PI3K inhibitors (e.g., wortmannin)

    • MAPK pathway inhibitors (e.g., PD98059)

    • Rho/ROCK inhibitors (e.g., Y-27632)

  • Receptor mutants: Compare responses between wild-type ZFCB1 and mutants with altered G-protein coupling or β-arrestin recruitment.

  • Positive controls: Include known compounds with established biphasic effects as positive controls to validate the experimental system.

When studying ZFCB1 effects on filopodia, detailed morphological analysis should include measurements of both length and density, accompanied by visualization of the actin cytoskeleton using fluorescent phalloidin or actin-GFP to directly observe structural changes.

What emerging technologies could advance ZFCB1 research?

Several cutting-edge technologies hold promise for advancing ZFCB1 research:

  • CRISPR/Cas9 genome editing: Generation of precise zebra finch knockin/knockout models to study ZFCB1 function in vivo within natural neural circuits.

  • Cryo-electron microscopy: Determination of ZFCB1 structure at atomic resolution to understand ligand binding sites and conformational changes, enabling structure-based drug design.

  • Optogenetics and chemogenetics: Cell-type-specific and temporally precise modulation of ZFCB1-expressing neurons to dissect circuit-level effects of cannabinoid signaling.

  • Single-cell transcriptomics: Identification of cell-type-specific gene expression changes following ZFCB1 activation to map downstream molecular pathways.

  • Biosensors: Development of FRET-based or intensity-based sensors to visualize ZFCB1 activation and signaling in real-time within living neurons.

  • Organoids: Generation of brain region-specific organoids from zebra finch stem cells to study ZFCB1 function in a more physiologically relevant context than traditional cell lines.

  • Artificial intelligence: Application of machine learning algorithms to analyze complex datasets integrating molecular, cellular, circuit, and behavioral measurements related to ZFCB1 function.

These technologies could help resolve current knowledge gaps regarding ZFCB1's role in vocal learning, species-specific pharmacological properties, and the precise molecular mechanisms underlying its effects on neuronal morphology and function.

How might comparative studies of avian and mammalian cannabinoid receptors inform therapeutic development?

Comparative studies of ZFCB1 and mammalian CB1 receptors could significantly impact therapeutic development through several mechanisms:

  • Identification of functionally important domains: Despite 92% sequence identity , subtle structural differences between avian and mammalian CB1 receptors may confer distinct pharmacological properties. Mapping these differences could identify receptor domains critical for specific functions.

  • Species-selective compounds: Development of compounds that selectively target either avian or mammalian CB1 receptors could serve as valuable research tools and potential leads for therapeutics with reduced off-target effects.

  • Pathway-biased signaling: Comparison of signaling pathways preferentially activated by ZFCB1 versus mammalian CB1 could identify naturally evolved biased signaling mechanisms that might be exploited therapeutically.

  • Evolutionary insights: Understanding how cannabinoid signaling has evolved across vertebrate lineages may reveal fundamental principles about receptor function and adaptation that inform drug design.

  • Novel therapeutic applications: ZFCB1's involvement in vocal learning suggests potential applications for cannabinoid-based therapies in speech and language disorders that might not be evident from mammalian studies alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.