Recombinant Takifugu rubripes 60S ribosomal protein L36a (rpl36a)

What is the molecular structure and function of 60S ribosomal protein L36a in Takifugu rubripes?

60S ribosomal protein L36a (RPL36A) in Takifugu rubripes (Japanese pufferfish) is a component of the large 60S ribosomal subunit. The protein consists of 105 amino acids (positions 2-106), with the sequence: VNVPKTRRTYCKKCKKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF .

Functionally, RPL36A serves as an integral component of the ribosomal machinery responsible for protein synthesis. It contributes to the structure and function of the 60S subunit, which works in concert with the 40S subunit to form the complete 80S ribosome in eukaryotes . The protein contains regions rich in basic amino acids (lysine and arginine), which facilitate interactions with negatively charged ribosomal RNA molecules.

Methodological approaches to studying the structure-function relationship of RPL36A include:

• X-ray crystallography or cryo-EM to determine three-dimensional structure

• RNA-protein interaction assays to characterize binding properties

• Mutational analysis to identify critical functional residues

• Comparative sequence analysis across species to identify conserved domains

How evolutionarily conserved is RPL36A across different species?

RPL36A shows remarkable evolutionary conservation across diverse species, indicating its fundamental importance in ribosomal function. The human RPL36A protein shares significant sequence similarity with yeast ribosomal protein L44 . This strong conservation extends to fish species, with RPL36A being identified in both Takifugu rubripes and Danio rerio (zebrafish) .

Analysis of conservation patterns reveals:

For researchers studying evolutionary biology, RPL36A represents an excellent candidate for phylogenetic analysis due to its:

• Slow evolutionary rate

• Presence in all eukaryotic organisms

• Essential function that constrains sequence divergence

• Available sequence data across numerous species

What is the relationship between RPL36A and alternative nomenclature such as RPL44?

The nomenclature surrounding RPL36A has experienced some inconsistency in the scientific literature. Although this gene has historically been referred to as ribosomal protein L44 (RPL44), its official designation is ribosomal protein L36a (RPL36A) . The protein belongs to the L44E (L36AE) family of ribosomal proteins and shares sequence similarity with yeast ribosomal protein L44 .

Researchers should be aware of this nomenclature complexity when conducting literature searches or database queries. In humans, there are distinct genes for RPL36A and ribosomal protein L36a-like (RPL36AL), which encode nearly identical proteins but are separate genetic loci . When designing primers or analyzing experimental data, it's essential to verify which specific gene or protein is being targeted.

Methodological considerations include:

• Using multiple search terms when conducting literature reviews

• Confirming gene identifiers across different genomic databases

• Cross-referencing with established nomenclature standards

• Specifying exact terminology in publications to avoid confusion

What expression systems are optimal for producing recombinant Takifugu rubripes RPL36A?

The selection of an appropriate expression system for recombinant Takifugu rubripes RPL36A depends on research objectives, required protein quality, and downstream applications. Based on available data, several expression platforms have distinct advantages and limitations:

The yeast expression system has been successfully employed for commercial production of recombinant Takifugu rubripes RPL36A with His-tag . This system offers several methodological advantages:

• It enables proper protein folding and post-translational modifications including glycosylation, acylation, and phosphorylation

• The produced protein closely resembles the native conformation

• The system is more economical than mammalian expression platforms

• Resulting proteins can serve as raw materials for downstream applications such as antibody production

For optimal expression, researchers should consider:

• Codon optimization for the selected expression host

• Signal sequence selection for proper subcellular targeting

• Purification tag placement to minimize interference with protein folding

• Growth and induction conditions specific to the expression system

What purification strategies yield the highest quality recombinant RPL36A protein?

Purification of recombinant Takifugu rubripes RPL36A requires carefully designed strategies to maintain protein integrity while achieving high purity. The His-tagged version of the protein enables efficient purification through immobilized metal affinity chromatography (IMAC) , but additional considerations can optimize results:

Recommended purification workflow:

• Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins to capture the His-tagged protein

• Intermediate purification: Ion exchange chromatography to separate based on charge differences

• Polishing step: Size exclusion chromatography to remove aggregates and achieve final purity

Critical buffer considerations:

• Include 50% glycerol in storage buffers to maintain stability

• Use Tris-based buffers at physiological pH for optimal protein stability

• Consider adding reducing agents if the protein contains exposed cysteine residues

• Test protease inhibitor cocktails to prevent degradation during purification

Quality control metrics:

Commercial preparations typically achieve >90% purity , which should be the minimum standard for research applications. Verification methods include:

• SDS-PAGE with Coomassie or silver staining

• Western blot using anti-His antibodies

• Mass spectrometry to confirm protein identity and integrity

• Dynamic light scattering to assess homogeneity and aggregation state

For long-term storage, lyophilization is an effective approach . Working aliquots should be stored at 4°C for up to one week, while long-term storage requires -20°C or -80°C temperatures . Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How can researchers effectively employ RPL36A in ELISA and other immunological applications?

The recombinant Takifugu rubripes RPL36A with His-tag is specifically suitable for ELISA applications , providing researchers with a valuable tool for various immunological studies. Implementing effective ELISA protocols with this protein requires attention to several methodological parameters:

Optimized ELISA protocol development:

• Coating optimization:

  • Test coating concentrations between 1-10 μg/mL

  • Compare carbonate/bicarbonate buffer (pH 9.6) versus PBS (pH 7.4)

  • Evaluate coating times (overnight at 4°C versus 2-4 hours at room temperature)

• Blocking conditions:

  • Assess different blocking agents (BSA, non-fat milk, commercial blockers)

  • Determine optimal blocking concentration (typically 1-5%)

  • Establish blocking time and temperature (1-2 hours at room temperature)

• Detection system selection:

  • Direct detection using anti-His antibodies

  • Indirect detection with antibodies against the RPL36A protein itself

  • Enzyme selection (HRP versus AP) based on sensitivity requirements

• Assay validation:

  • Determine limits of detection and quantification

  • Establish standard curves using purified protein

  • Assess cross-reactivity with related proteins

  • Evaluate precision through intra- and inter-assay coefficients of variation

For antibody production, the yeast-expressed recombinant RPL36A protein serves as an excellent immunogen . The resulting antibodies can be employed in various applications beyond ELISA, including Western blotting, immunohistochemistry, and immunoprecipitation, enabling comprehensive analysis of RPL36A in experimental systems.

How can differential expression of RPL36A be accurately measured in comparative fish studies?

Accurate measurement of RPL36A differential expression in comparative fish studies requires rigorous methodological approaches to ensure reliable data. Several techniques provide complementary information, each with distinct advantages for specific research questions:

Critical considerations for expression analysis:

• Sample preparation:

  • Standardize tissue collection protocols across specimens

  • Minimize time between sampling and RNA extraction/preservation

  • Verify RNA integrity (RIN value >8) before proceeding with analysis

  • Remove genomic DNA contamination through DNase treatment

• Reference gene selection:

  • Since RPL36A itself is a ribosomal protein often used as a reference gene, careful selection of alternative reference genes is essential

  • Test multiple candidate reference genes for stability across experimental conditions

  • Use algorithms such as geNorm or NormFinder to identify optimal reference genes

  • Consider geometric averaging of multiple reference genes rather than relying on a single gene

• Experimental design factors:

  • Include biological replicates (minimum n=3, preferably n≥5)

  • Account for potential confounding variables (age, sex, feeding status)

  • Consider time-course experiments to capture expression dynamics

  • Include appropriate positive and negative controls

This methodological rigor is particularly important when studying ribosomal proteins like RPL36A, which may show subtle but biologically significant expression changes under different experimental conditions or across developmental stages.

What role does RPL36A play in stress response studies in fish models?

Ribosomal proteins, including RPL36A, have emerged as interesting candidates in stress response studies in fish models. While traditional views considered ribosomal proteins primarily as housekeeping genes, growing evidence suggests they may play regulatory roles under stress conditions. Although the search results don't directly address RPL36A in stress responses, they do mention studies involving differential gene expression under various stress conditions in fish .

Experimental approaches for investigating RPL36A in stress responses:

• Stress induction protocols:

  • Chronic confinement stress to simulate crowding conditions

  • Acute handling stressors to model capture and transport stress

  • Immune challenges through LPS intraperitoneal injection

  • Environmental stressors (temperature, salinity, hypoxia)

• Multi-level analysis framework:

  • Transcriptional changes in RPL36A expression (RT-qPCR, microarray, RNA-seq)

  • Protein-level alterations (Western blot, proteomics)

  • Post-translational modifications under stress conditions

  • Subcellular localization changes in response to stressors

  • Correlation with physiological stress markers (cortisol, glucose)

• Tissue-specific considerations:

  • Head kidney as a primary site for stress and immune responses

  • Brain regions involved in stress axis regulation

  • Liver as a major metabolic organ responding to stress

  • Gill tissue for examining environmental stressor effects

Understanding how RPL36A expression responds to different stressors could reveal new insights into the coordination between protein synthesis machinery and stress adaptation mechanisms in fish. Additionally, correlation between RPL36A expression patterns and established stress markers like cortisol and glucose levels may identify potential applications as a novel stress biomarker.

How does the structure and function of Takifugu rubripes RPL36A compare with mammalian homologs?

Comparative analysis of Takifugu rubripes RPL36A with mammalian homologs provides valuable insights into evolutionary conservation of ribosomal proteins and potential functional adaptations. The RPL36A protein sequence from Takifugu rubripes (VNVPKTRRTYCKKCKKHQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF) can be compared with mammalian homologs to identify conserved and divergent features.

Structural comparison methodology:

• Sequence alignment analysis:

  • Multiple sequence alignment of RPL36A from Takifugu rubripes, human, and other model organisms

  • Identification of conserved residues, particularly those involved in RNA binding and structural stability

  • Calculation of sequence identity and similarity percentages

  • Mapping of conservative versus non-conservative substitutions

• Domain organization assessment:

  • Identification of functional domains through computational prediction

  • Comparison of domain architecture across species

  • Analysis of potential fish-specific structural features

• Structural prediction and modeling:

  • Homology modeling based on available ribosomal structures

  • Prediction of secondary structure elements (alpha helices, beta sheets)

  • Assessment of potential structural divergence between fish and mammalian proteins

While both fish and mammalian RPL36A proteins function within the ribosomal complex, species-specific adaptations may relate to:

• Temperature adaptations (cold-water fish versus warm-blooded mammals)

• Regulatory regions affecting expression patterns

• Interaction interfaces with species-specific binding partners

• Post-translational modification sites

This comparative approach not only illuminates evolutionary relationships but also provides context for interpreting experimental results across different model systems.

What are the technical challenges in studying RPL36A function in ribosomal assembly and protein synthesis?

Investigating the precise function of RPL36A in ribosomal assembly and protein synthesis presents several technical challenges that require specialized methodological approaches:

Major technical challenges:

• Functional redundancy:

  • Ribosomal proteins often have partially overlapping functions

  • Compensatory mechanisms may mask phenotypes in knockout models

  • Subtle functional contributions can be difficult to isolate

• Integration within complex structures:

  • RPL36A functions as part of the large ribosomal complex

  • Isolating its specific contribution requires sophisticated approaches

  • Structural perturbations may have cascading effects

• Essential nature:

  • Complete knockout may be lethal or severely affect development

  • Conditional or tissue-specific knockouts may be necessary

  • Partial knockdown can result in compensatory upregulation of related genes

Methodological solutions:

• Advanced genetic manipulation approaches:

  • CRISPR/Cas9-mediated precise editing to create specific mutations

  • Conditional knockout systems (Cre-Lox) for temporal control

  • Degron-based approaches for rapid protein depletion

  • Tissue-specific promoters for localized manipulation

• Ribosome profiling and structural biology:

  • Ribosome profiling to assess translation efficiency and fidelity

  • Cryo-EM to visualize RPL36A positioning within the ribosome

  • Cross-linking and mass spectrometry to map interaction networks

  • In vitro reconstitution experiments with purified components

• Cellular and in vivo assays:

  • Polysome profiling to assess impact on translation

  • Reporter assays for measuring translation rates

  • Growth curve analysis under various stressors

  • Developmental phenotyping with careful staging

These advanced approaches, while technically challenging, can provide unprecedented insights into the specific roles of RPL36A within the complex process of ribosome assembly and protein synthesis in fish models.

What are the most promising future research directions for Takifugu rubripes RPL36A studies?

Research on Takifugu rubripes RPL36A presents several promising future directions that could significantly advance our understanding of ribosomal biology in fish and comparative vertebrate systems:

Emerging research opportunities:

• Comparative functional genomics:

  • Leveraging the compact genome of Takifugu rubripes (approximately one-eighth the size of mammalian genomes)

  • Comparing RPL36A function across evolutionarily diverse fish species

  • Identifying fish-specific adaptations in ribosomal structure and function

  • Developing Takifugu rubripes as a model for specialized ribosome studies

• Regulatory roles beyond protein synthesis:

  • Investigating potential extraribosomal functions of RPL36A

  • Examining RPL36A in cellular stress responses and environmental adaptation

  • Studying potential regulatory interactions with non-coding RNAs

  • Exploring role in specialized translation programs during development

• Environmental and ecological applications:

  • Using RPL36A as a biomarker for environmental stress in aquatic ecosystems

  • Studying expression changes in response to climate-related stressors

  • Investigating potential adaptations in fish populations from different habitats

  • Application in aquaculture optimization and fish health monitoring

• Translational research potential:

  • Comparative studies to inform human ribosomal disease research

  • Development of fish models for ribosomopathies

  • Drug screening for compounds affecting ribosomal function

  • Identification of conservation-based therapeutic targets

These research directions would benefit from integrative approaches combining:

• Advanced genomic and transcriptomic technologies

• Structural biology techniques (cryo-EM, X-ray crystallography)

• Genetic manipulation in model fish systems

• Environmental and ecological field studies

By pursuing these innovative directions, researchers can expand our understanding of RPL36A beyond its classical role in protein synthesis to explore its broader biological significance in fish biology and comparative vertebrate physiology.

How does current knowledge of Takifugu rubripes RPL36A contribute to our broader understanding of ribosomal biology?

The study of Takifugu rubripes RPL36A provides valuable insights that extend beyond fish biology to enhance our general understanding of ribosomal structure, function, and evolution. The high degree of conservation observed in RPL36A across species from yeast to humans underscores the fundamental importance of this protein in the essential cellular process of protein synthesis.

Key contributions of Takifugu rubripes RPL36A research include:

• Evolutionary insights derived from comparing this compact fish genome with other vertebrate models

• Structure-function relationships illuminated through comparative analysis across diverse species

• Technical advances in recombinant protein production using various expression systems

• Model systems for studying specialized ribosome function in different physiological contexts

Future studies combining classical biochemical approaches with cutting-edge technologies in genomics, proteomics, and structural biology will continue to expand our understanding of this essential ribosomal component. The availability of recombinant Takifugu rubripes RPL36A provides researchers with valuable tools to explore these questions through diverse experimental approaches.

As we deepen our understanding of RPL36A and other ribosomal components across species, we gain not only fundamental biological knowledge but also potential applications in fields ranging from evolutionary biology to biomedical research and environmental monitoring.