Recombinant Takifugu rubripes D (1)-like dopamine receptor

What is the genetic structure of Takifugu rubripes D(1)-like dopamine receptor?

The D(1)-like dopamine receptor in Takifugu rubripes (Japanese pufferfish) is encoded by the d14 gene. The full-length protein consists of 459 amino acids with a complete sequence that has been characterized. The receptor shows high sequence and structural homology to known dopamine receptor genes in other vertebrates, including humans. Notably, despite the Fugu genome being approximately 400 Mb (7.5 times smaller than the human genome), the intron size of the dopamine receptor genes is comparable to that in humans, unlike other genes previously described from this species . The receptor is classified as part of the D1-like family based on its structural characteristics and pharmacological properties.

How is the D(1)-like dopamine receptor conserved across fish species?

The D(1)-like dopamine receptor shows remarkable conservation across different fish species. In zebrafish, D1 receptors (D1-Rs) are highly homologous to mammalian counterparts at the nucleotide sequence level, suggesting similar structural and functional characteristics . This conservation extends to the Takifugu rubripes D(1)-like receptor, which shares significant sequence homology with dopamine receptors found in other fish. This evolutionary conservation suggests the fundamental importance of dopaminergic signaling pathways across vertebrates and makes fish models valuable for comparative studies of dopamine receptor function and pharmacology.

What are the optimal storage conditions for recombinant Takifugu rubripes D(1)-like dopamine receptor?

For short-term storage, recombinant Takifugu rubripes D(1)-like dopamine receptor should be stored at -20°C in a Tris-based buffer with 50% glycerol. For extended storage periods, maintaining the protein at -20°C or -80°C is recommended . Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing is not recommended and may compromise protein integrity . The protein is typically optimized in its buffer formulation to maintain stability and functionality, though specific buffer components may vary depending on the production process.

How can researchers effectively design experiments to study the pharmacological properties of Takifugu rubripes D(1)-like dopamine receptor?

When designing experiments to study the pharmacological properties of Takifugu rubripes D(1)-like dopamine receptor, researchers should consider a multi-faceted approach:

• Receptor binding assays: Utilize compounds with known affinity for D1 receptors such as the agonist SKF-38393 and the antagonist SCH-23390, which have been successfully employed in studies with fish dopamine receptors . Determine binding constants and compare with mammalian D1 receptors to assess conservation of binding sites.

• Functional assays: Since D1 receptors typically couple to Gs proteins to stimulate adenylyl cyclase, measure cAMP production in response to agonist stimulation with and without antagonist pre-treatment.

• Tissue expression profiling: Use quantitative real-time PCR (qPCR) and in situ hybridization (ISH) to determine the expression pattern of the receptor in different tissues and at different developmental stages .

• Cross-species comparative analysis: Compare pharmacological properties with D1 receptors from other fish species like zebrafish, which have well-characterized dopaminergic systems .

• Mutational analysis: Create targeted mutations in key residues to identify critical domains for ligand binding and signal transduction.

This multifaceted approach allows for comprehensive characterization of the receptor's pharmacological properties and evolutionary relationships.

What are the methodological considerations for using recombinant Takifugu rubripes D(1)-like dopamine receptor in binding studies?

When conducting binding studies with recombinant Takifugu rubripes D(1)-like dopamine receptor, researchers should consider the following methodological aspects:

• Protein preparation: Ensure the recombinant protein maintains its native conformation. The full-length protein (expression region 1-459) should be used to preserve all binding domains .

• Buffer composition: Optimize buffer conditions (pH, ionic strength) to maintain receptor stability and functionality during binding assays.

• Ligand selection: Use established D1 receptor ligands such as SCH-23390 (antagonist) and SKF-38393 (agonist) that have been validated in fish models . Starting concentrations can be based on previous studies: approximately 0.5 μg/g body weight for SCH-23390 and 5.0 μg/g body weight for SKF-38393, though these should be adjusted for in vitro studies .

• Detection methods: Consider using radioligand binding assays with [³H]-labeled ligands or fluorescence-based techniques for measuring binding affinities.

• Controls: Include appropriate controls such as non-specific binding determination (using excess unlabeled ligand) and comparison with mammalian D1 receptors to benchmark pharmacological properties.

• Data analysis: Use appropriate mathematical models (Scatchard, Hill plots) to derive binding constants (Kd, Bmax) and assess binding cooperativity.

These considerations help ensure reliable and reproducible binding data that can be compared across studies and species.

How does the Takifugu rubripes D(1)-like dopamine receptor compare structurally and functionally to mammalian D1 receptors?

The Takifugu rubripes D(1)-like dopamine receptor shares significant structural homology with mammalian D1 receptors, reflecting the evolutionary conservation of these important signaling molecules . Key comparisons include:

• Sequence homology: The high nucleotide sequence homology between fish and mammalian D1 receptor genes translates to similar amino acid sequences and predicted protein structures. This conservation is particularly evident in the transmembrane domains and ligand binding regions .

• Pharmacological profile: Studies in related fish species indicate that fish D1 receptors respond to classical D1 ligands such as the antagonist SCH-23390 and the agonist SKF-38393 in a manner similar to mammalian receptors . The D1 receptor agonist SKF-38393 has been shown to improve learning capacity in fish, suggesting functional conservation of cognitive roles .

• Intracellular signaling: Like mammalian D1 receptors, fish D1 receptors are believed to primarily couple to Gs proteins to stimulate adenylyl cyclase and increase intracellular cAMP levels.

• Structural features: The Takifugu D1 receptor maintains the characteristic seven-transmembrane domain structure typical of G-protein coupled receptors. The amino acid sequence (MAQNFSTVGDGKQMLLERDSSKRVLTGCFLSLLIFTTLLGNTLVCVAVTKFRHLRSKVTN...) reveals conserved structural motifs important for receptor function .

Despite these similarities, species-specific differences in ligand binding affinities and downstream signaling pathways may exist and represent areas for further comparative research.

What insights does the compact genome of Takifugu rubripes provide for dopamine receptor evolution studies?

The compact genome of Takifugu rubripes offers several valuable insights for dopamine receptor evolution studies:

• Gene family identification: The Fugu genome, approximately 400 Mb and 7.5 times smaller than the human genome, provides an efficient system for identifying complete gene families, including dopamine receptors . Four dopamine receptor-like genes have been isolated from Fugu genomic DNA, showing high sequence and structural homology to known dopamine receptor genes .

• Intron conservation: Interestingly, unlike many other genes in the compact Fugu genome, dopamine receptor genes maintain intron sizes comparable to those in humans . This selective conservation suggests functional importance of these intronic regions, possibly in regulating gene expression.

• Synteny analysis: The high gene density of Fugu is demonstrated by the close proximity of a cystatin-like gene just 1503 bp from one dopamine receptor gene (D222) . Such genomic arrangements can provide insights into the evolutionary history of these loci through comparative synteny analysis.

• Minimalist genomic model: The Fugu genome represents a "minimalist" vertebrate genome that has retained essential gene functions while eliminating much non-coding DNA. Comparing dopamine receptor gene organization across species can illuminate which genetic elements are dispensable versus essential.

• Evolutionary rate assessment: Studying sequence divergence between Fugu and other vertebrate dopamine receptors allows researchers to assess evolutionary rates and selective pressures on different receptor domains.

These features make Takifugu rubripes an excellent model for evolutionary studies of dopamine receptors and other gene families.

How can the Takifugu rubripes D(1)-like dopamine receptor be utilized in drug discovery and screening?

The Takifugu rubripes D(1)-like dopamine receptor offers several advantages for drug discovery and screening programs:

• Alternative pharmacological profile: The fish D1 receptor may exhibit subtle differences in ligand binding properties compared to mammalian receptors, potentially allowing the identification of novel pharmacophores with unique specificity profiles.

• High-throughput screening platforms: Recombinant expression of the Takifugu D1 receptor in cell lines enables the development of functional assays measuring secondary messengers (cAMP) or receptor internalization for screening compound libraries.

• Structure-based drug design: The amino acid sequence of the Takifugu D1 receptor (MAQNFSTVGDGKQMLLERDSSKRVLTGCFLSLLIFTTLLGNTLVCVAVTKFRHLRSKVTN...) can be used for homology modeling to predict three-dimensional structure . This structural information can guide the design of novel ligands with enhanced specificity or modified properties.

• Selectivity assessment: Testing compounds against both mammalian and fish D1 receptors can identify ligands with species selectivity, which may provide insights into critical binding determinants and evolutionary conservation of functional domains.

• Behavioral correlates: Studies in zebrafish have demonstrated that D1 receptor activation via SKF-38393 improves learning capacity , suggesting that the development of novel D1 agonists could potentially yield cognitive enhancers with therapeutic applications.

These applications leverage the unique properties of the Takifugu receptor while building on established methodologies in dopamine receptor pharmacology.

What are the challenges in expressing and purifying functional recombinant Takifugu rubripes D(1)-like dopamine receptor for structural studies?

Expressing and purifying functional G-protein coupled receptors (GPCRs) like the Takifugu rubripes D(1)-like dopamine receptor presents several significant challenges for structural studies:

• Membrane protein expression: As a seven-transmembrane domain protein, the D1 receptor requires a membrane environment for proper folding. Expression systems must maintain the receptor in a native-like lipid environment or provide suitable detergents for solubilization.

• Post-translational modifications: Fish D1 receptors may undergo specific post-translational modifications that affect function. Expression systems should ideally preserve these modifications, which may require eukaryotic expression hosts.

• Protein stability: GPCRs are often inherently unstable when removed from their native membrane environment. Stabilization strategies might include:

  • Addition of specific ligands during purification

  • Introduction of stabilizing mutations

  • Use of lipid nanodiscs or other membrane mimetics

• Conformational homogeneity: For structural studies, a homogeneous conformation is preferable. The dynamic nature of GPCRs presents challenges in capturing specific functional states.

• Purification yields: Typical expression yields for membrane proteins are lower than for soluble proteins. Scale-up strategies and optimization of expression conditions (temperature, induction parameters) are critical for obtaining sufficient material for structural studies.

• Tag selection and placement: The tag type and position can significantly impact receptor functionality and purification efficiency. As noted in the product information, "The tag type will be determined during production process" , highlighting the empirical nature of optimizing tag placement for these challenging proteins.

Addressing these challenges requires a multifaceted approach combining advances in membrane protein expression technology with receptor-specific optimization strategies.

How can researchers investigate the role of miRNAs in regulating D(1)-like dopamine receptor expression in Takifugu rubripes?

Investigating miRNA regulation of the D(1)-like dopamine receptor in Takifugu rubripes requires a systematic approach:

• Bioinformatic prediction: Analyze the 3'UTR of the Takifugu D(1) receptor mRNA for potential miRNA binding sites using tools like TargetScan Fish or miRanda. Search for conserved sites across fish species to identify functionally important regulatory elements.

• Expression correlation studies: Based on findings in zebrafish that cocaine exposure alters both dopamine receptor and miRNA expression , researchers can design experiments to:

  • Quantify D(1) receptor and candidate miRNA expression across tissues and developmental stages using qPCR

  • Identify miRNAs whose expression patterns inversely correlate with D(1) receptor expression

  • Map the spatial distribution of receptor and miRNA expression using in situ hybridization

• Functional validation:

  • Perform luciferase reporter assays with the 3'UTR of the D(1) receptor gene to confirm direct miRNA targeting

  • Use miRNA mimics and inhibitors in cell culture systems expressing the Takifugu D(1) receptor to manipulate miRNA levels

  • Create site-directed mutations in predicted miRNA binding sites to confirm specificity

• In vivo studies: Based on the zebrafish model that demonstrated miR-133b involvement in dopaminergic system development , researchers can:

  • Use morpholinos or CRISPR/Cas9 to modulate expression of candidate miRNAs

  • Assess consequent changes in D(1) receptor expression at mRNA and protein levels

  • Evaluate behavioral outcomes related to dopaminergic signaling

• Pharmacological interventions: Test whether drugs that affect dopaminergic signaling (like cocaine in the zebrafish study ) alter the expression of both D(1) receptors and regulatory miRNAs in Takifugu models.

This comprehensive approach can reveal important post-transcriptional regulatory mechanisms controlling dopamine receptor expression in fish models.

What behavioral paradigms are most effective for studying D(1)-like dopamine receptor function in fish models?

Several behavioral paradigms have proven effective for studying D(1)-like dopamine receptor function in fish models:

• Social preference tests: Studies in zebrafish have demonstrated that D1 receptor antagonism with SCH23390 causes dose-dependent disruption of social preference behavior . Similar paradigms could be adapted for other fish species to assess the role of D1-like receptors in social behaviors.

• Learning and discrimination tasks: Research with cleaner wrasse has shown that D1 receptor agonist treatment with SKF-38393 significantly improves learning in cue discrimination and side discrimination tasks . These findings demonstrate that:

  • Cleaners injected with D1 agonist required fewer sessions to learn a cue discrimination task (F₁,₉ = 6.69, p = 0.03)

  • Similar improvement was observed in side discrimination tasks (F₁,₉ = 5.49, p = 0.04)

  • Learning curves for D1 agonist treatment were distinct from all other treatments

• Conditioned place preference: This paradigm can assess reward-related functions of dopamine receptors by measuring preference for environments associated with D1 receptor agonists or antagonists.

• Locomotor activity assays: Since dopamine regulates motor function across vertebrates, quantitative assessment of swimming patterns and activity levels following pharmacological manipulation of D1 receptors provides insight into motor control functions.

• Developmental behavioral assessments: Given findings that cocaine exposure affects dopamine receptor expression in developing zebrafish embryos , behavioral paradigms that track developmental milestones can reveal the role of D1 receptors in the ontogeny of behavior.

These paradigms, combined with pharmacological manipulation using selective D1 agonists (e.g., SKF-38393) and antagonists (e.g., SCH-23390), provide a powerful toolkit for assessing the behavioral roles of D1-like receptors in fish models.

How does differential expression of D(1)-like dopamine receptors during development impact fish behavior and physiology?

The differential expression of D(1)-like dopamine receptors during development has significant implications for fish behavior and physiology:

• Developmental trajectory: Studies in zebrafish have revealed that dopamine receptor expression is dynamically regulated during embryonic and larval development . Cocaine exposure experiments demonstrated that expression of dopamine receptors (including drd1) is altered in a stage-specific manner, suggesting critical developmental windows when dopaminergic signaling shapes neural circuits .

• Neurological development: D1 receptor signaling contributes to the development and refinement of neural circuits, particularly within the basal ganglia and related structures. Perturbations in this signaling during critical periods can result in persistent alterations in circuit function.

• Behavioral phenotypes: The developmental expression pattern of D1 receptors influences the emergence of behaviors including:

  • Motor coordination and swimming patterns

  • Response to novel environments

  • Social interaction capabilities

  • Learning and memory formation

• Strain-specific differences: Previous research has identified behavioral and neurochemical differences between genetically distinct zebrafish populations (AB and SF) in response to dopaminergic system manipulations . These population differences suggest genetic factors influencing D1 receptor development and function that may extend to other fish species.

• Environmental interactions: Environmental factors can interact with developmental D1 receptor expression. For example, exposure to substances like cocaine during development alters dopamine receptor expression patterns , potentially through mechanisms involving miRNA regulation, leading to long-term behavioral consequences.

Understanding these developmental dynamics is essential for interpreting adult phenotypes and may provide insights into neurodevelopmental processes conserved across vertebrates.

What are the most common technical challenges when working with recombinant Takifugu rubripes D(1)-like dopamine receptor and how can they be addressed?

Researchers working with recombinant Takifugu rubripes D(1)-like dopamine receptor commonly encounter several technical challenges:

• Protein stability issues:

  • Challenge: The receptor may show reduced stability after purification or during experimental procedures.

  • Solution: Store in optimized buffer with 50% glycerol at recommended temperatures (-20°C or -80°C for long-term) . Avoid repeated freeze-thaw cycles by preparing single-use aliquots.

• Functional reconstitution:

  • Challenge: Maintaining receptor functionality in artificial membrane systems.

  • Solution: Experiment with different lipid compositions and detergents; consider using nanodiscs or liposomes that better mimic the native membrane environment.

• Low expression yields:

  • Challenge: GPCRs typically express at lower levels than soluble proteins.

  • Solution: Optimize expression conditions including temperature, induction timing, and host cell selection. Consider specialized expression systems designed for membrane proteins.

• Assay development:

  • Challenge: Establishing reliable functional assays for ligand binding or signaling.

  • Solution: Adapt established protocols for mammalian D1 receptors, using ligands like SCH-23390 (antagonist) and SKF-38393 (agonist) that have been validated in fish models .

• Cross-reactivity issues:

  • Challenge: Antibodies or ligands may show different specificity for fish vs. mammalian receptors.

  • Solution: Validate reagents specifically with the Takifugu receptor; consider developing custom antibodies if commercial options lack specificity.

• Receptor heterogeneity:

  • Challenge: Multiple conformational states can complicate structural and functional studies.

  • Solution: Use ligands to stabilize specific conformations; consider adding stabilizing mutations validated in other GPCR systems.

Addressing these challenges requires iterative optimization and adaptation of protocols based on the specific properties of the Takifugu D1-like receptor.

What neurochemical analysis techniques are most appropriate for studying Takifugu rubripes dopaminergic systems?

Several neurochemical analysis techniques are particularly well-suited for studying Takifugu rubripes dopaminergic systems:

• High-Performance Liquid Chromatography (HPLC) with Electrochemical Detection:

  • Allows quantification of dopamine, its metabolite DOPAC, and other monoamines like serotonin and its metabolite 5HIAA from brain extracts

  • Has been successfully applied in related fish species to measure neurotransmitter levels following pharmacological interventions

  • Provides high sensitivity necessary for the relatively small tissue samples obtained from fish

• Quantitative Real-Time PCR (qPCR):

  • Enables precise measurement of dopamine receptor gene expression levels

  • Has been used to track changes in dopamine receptor expression (drd1, drd2a, drd2b, drd3) during development and following drug exposure in zebrafish

  • Can detect subtle changes in expression levels across different brain regions or developmental stages

• In Situ Hybridization (ISH):

  • Provides spatial information about dopamine receptor expression

  • Particularly valuable for developmental studies to map the ontogeny of dopaminergic system components

  • Has been effectively combined with qPCR in zebrafish studies to correlate expression levels with anatomical distribution

• Receptor Autoradiography:

  • Allows visualization of receptor distribution using radiolabeled ligands

  • Can provide quantitative measures of receptor density in specific brain regions

  • Useful for comparative studies between species or following experimental manipulations

• Fast-Scan Cyclic Voltammetry (FSCV):

  • Enables real-time measurement of dopamine release in specific brain regions

  • Provides high temporal resolution to capture dynamic changes in dopaminergic signaling

  • Has been adapted for use in several fish species

• Microdialysis:

  • Allows sampling of extracellular fluid to measure neurotransmitter release in vivo

  • Can be combined with behavioral studies to correlate neurochemical changes with behavioral outputs

  • Requires adaptation of probes and techniques for the smaller brain size of fish

These techniques, particularly when used in combination, provide comprehensive analysis of the dopaminergic system in Takifugu rubripes and related fish models.