Recombinant Takifugu rubripes Protein lunapark-B (lnpb)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lnpkb; lnpb; Endoplasmic reticulum junction formation protein lunapark-B; ER junction formation factor lunapark
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
Target Names
lnpkb
Target Protein Sequence
MGAIISRWKTKLTTVEQLENIDKEIKQLEEFRAKNQRLQKLWVGRLLLYSSALYLLISLF VYLLYLPEQWLLRLAMALPFFIYPVLVWFIRRFLIFLFSKRSERNNDKLEDLKATKKKIL EEVMETETYKNAKAILERFDPDAKKKPELEATPVRPQMTPGAGQELRQRGVALRHMPMGT PVAVTPGARPPLGPGGTPVERVPLSAPGGPPERSGLAASVQMTPRSLGSPVPGVGMHPPG PPLARPVLPKDRGAVDRVIEYLVGDGPQNRYALICQQCFSHNGMALKEEFEYLAFRCAYC YFLNPARKMRPQAPRLPEFNFEKRLRAESSTPGPAPHSATDTEESAPPSRGMDKHGRA
Uniprot No.

Target Background

Function

Lunapark-B (Lnpb) is an endoplasmic reticulum (ER)-shaping membrane protein crucial for ER morphology. It stabilizes nascent three-way ER tubular junctions within the ER network and may also function as a curvature-stabilizing protein within this network.

Database Links
Protein Families
Lunapark family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is Takifugu rubripes Protein lunapark-B (lnpb) and what is its function?

Takifugu rubripes Protein lunapark-B (lnpb) is an endoplasmic reticulum (ER) junction formation protein found in the Japanese pufferfish (Fugu rubripes). This protein plays a critical role in the formation and maintenance of ER tubular networks and junctions . The protein is encoded by the lnpb gene, also known as lnpkb in some databases . The full-length protein consists of 358 amino acids and, based on its mammalian homologs, is likely involved in stabilizing three-way junctions in the ER tubular network.

Research methodological approach: To study the function of lunapark-B, researchers typically use fluorescent tagging combined with confocal microscopy to observe its localization within the cell. Knockdown experiments using siRNA or CRISPR-Cas9 can reveal phenotypic changes in ER morphology resulting from reduced lunapark-B expression.

How is recombinant Takifugu rubripes Protein lunapark-B typically expressed and purified?

Recombinant Takifugu rubripes Protein lunapark-B is typically expressed in E. coli expression systems with a His-tag fusion at the N-terminus to facilitate purification . The recommended protocol includes:

  • Transformation of the expression vector containing the full-length (1-358 aa) lnpb gene into a suitable E. coli strain

  • Induction of protein expression (similar methods to those used for other fish proteins, like the nalidixic acid induction used for pufferfish leptin )

  • Harvesting and lysis of bacterial cells

  • Purification via nickel affinity chromatography, taking advantage of the His-tag

  • Further purification using ion exchange chromatography and gel filtration

Based on similar recombinant proteins from Takifugu rubripes, the protein may form inclusion bodies when overexpressed, requiring solubilization and refolding steps during purification .

Purification StepMethodExpected Outcome
Initial captureNi-NTA affinity chromatography>80% purity
Intermediate purificationAnion-exchange chromatography>90% purity
PolishingSize-exclusion chromatography>95% purity

Research methodological approach: Optimization of expression conditions is critical and may include testing different E. coli strains, induction temperatures (16-37°C), inducer concentrations, and expression times to maximize soluble protein yield.

How does hypoxia affect the expression of lunapark-B in Takifugu rubripes tissues?

While specific data on lunapark-B expression under hypoxic conditions is limited, transcriptome analysis of Takifugu rubripes brain tissue under hypoxia reveals significant changes in gene expression patterns . The brain is particularly sensitive to hypoxia, and many genes involved in endoplasmic reticulum function show altered expression under hypoxic stress.

Research methodological approach: To investigate lunapark-B expression specifically under hypoxia:

  • Design qPCR primers targeting the lnpb gene

  • Expose Takifugu rubripes specimens or cell cultures to controlled hypoxic conditions

  • Isolate RNA from tissues of interest (brain, liver, etc.)

  • Perform RT-qPCR to quantify changes in lnpb mRNA levels

  • Validate findings at the protein level using Western blot analysis

What is the optimal buffer composition for maintaining stability of purified recombinant Takifugu rubripes Protein lunapark-B?

Based on available data for similar recombinant proteins from Takifugu rubripes, the recommended storage buffer for maintaining stability of lunapark-B consists of Tris-based buffer with 50% glycerol at pH 8.0 . The high glycerol concentration helps prevent protein aggregation and maintain stability during freeze-thaw cycles.

Buffer ComponentConcentrationPurpose
Tris20-50 mMpH buffer
NaCl150-300 mMIonic strength
Glycerol50%Stabilizer
DTT or β-mercaptoethanol1-5 mMReducing agent (optional)
EDTA1 mMChelating agent (optional)

Research methodological approach: Differential scanning fluorimetry (DSF) or thermal shift assays can be used to optimize buffer conditions by measuring protein thermal stability across various buffer compositions. Stability can be further assessed by monitoring protein activity over time under different storage conditions.

What protein-protein interactions have been identified for Takifugu rubripes Protein lunapark-B?

Research methodological approach: To identify protein-protein interactions:

  • Perform co-immunoprecipitation (Co-IP) experiments using anti-His antibodies to pull down the recombinant His-tagged lunapark-B and its interacting partners

  • Apply proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

  • Use yeast two-hybrid screening to identify direct binding partners

  • Validate identified interactions using techniques such as FRET or BiFC in cellular contexts

How can gene expression studies of lunapark-B in Takifugu rubripes be designed to understand its role in development?

Gene expression studies for lunapark-B should incorporate both spatial and temporal dimensions to understand its role in development. Drawing from methodologies used in similar studies with Takifugu rubripes genes :

  • Sample collection strategy:

    • Collect embryos at multiple developmental stages

    • Dissect tissues from juvenile and adult specimens

    • Include diverse tissue types (brain, liver, gonads, etc.)

  • Expression analysis methods:

    • RNA-seq for genome-wide context

    • RT-qPCR for targeted quantification

    • In situ hybridization for spatial localization

    • Western blotting for protein-level verification

  • Functional validation:

    • Morpholino knockdown in embryos

    • CRISPR-Cas9 genome editing for genetic models

    • Rescue experiments with wild-type and mutant constructs

Research methodological approach: Integrate epigenetic analyses such as DNA methylation profiling, which has been successfully applied to study gene regulation in Takifugu rubripes . This can reveal regulatory mechanisms controlling lunapark-B expression during development and in response to environmental changes.

What are the considerations for experimental design when comparing lunapark-B function across different Takifugu species?

When designing experiments to compare lunapark-B function across different Takifugu species (such as T. rubripes, T. chinensis, and T. pseudommus), several factors should be considered :

  • Genomic analysis prerequisites:

    • Conduct sequence alignments to identify conserved and variable regions

    • Design primers/probes that account for species-specific variations

    • Verify specificity using in silico PCR against available genomes

  • Experimental controls:

    • Use housekeeping genes validated across all target species

    • Include biological replicates (n≥3) for each species

    • Standardize tissue collection, storage, and processing methods

  • Analytical approaches:

    • Apply phylogenetic analysis to understand evolutionary relationships

    • Use comparative genomics to identify structural variations

    • Consider the impact of genetic variations on protein function

Based on research with Takifugu species, using SSR (simple sequence repeat) markers developed from one species to study related species has proven effective for genetic analysis .

Research methodological approach: A multi-omics approach combining genomics, transcriptomics, and proteomics can provide comprehensive insights into functional similarities and differences of lunapark-B across Takifugu species.

What are the recommended quality control procedures for recombinant Takifugu rubripes Protein lunapark-B?

Quality control for recombinant Takifugu rubripes Protein lunapark-B should include the following procedures:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (target: >90% purity)

    • Western blot using anti-His antibodies to confirm identity

    • Mass spectrometry to verify protein mass and sequence

  • Functional assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure

    • Thermal stability assays to determine melting temperature

    • Activity assays based on ER morphology regulation (if applicable)

  • Storage stability:

    • Analyze aliquots stored under recommended conditions (-20°C/-80°C) at various time points

    • Monitor for degradation using SDS-PAGE

    • Test functional activity after storage periods

Research methodological approach: Dynamic light scattering (DLS) can be used to assess protein homogeneity and detect aggregation. For structural analysis, small-angle X-ray scattering (SAXS) provides insights into protein shape and oligomeric state in solution.

How can researchers optimize transfection methods for studying lunapark-B function in fish cell lines?

Optimizing transfection methods for fish cell lines to study lunapark-B function requires careful consideration of several factors:

  • Cell line selection:

    • Choose cell lines derived from Takifugu rubripes when possible

    • Alternative fish cell lines like zebrafish ZF4 or medaka OLHNI-2 may serve as models

  • Transfection optimization:

    • Test chemical methods (lipofection, calcium phosphate)

    • Evaluate physical methods (electroporation, nucleofection)

    • Adjust DNA:transfection reagent ratios systematically

  • Expression vector considerations:

    • Use promoters active in fish cells (e.g., cytomegalovirus, SV40)

    • Include appropriate selectable markers for stable transfection

    • Consider codon optimization for expression efficiency

  • Validation methods:

    • Quantify transfection efficiency using reporter genes (GFP, luciferase)

    • Verify protein expression by Western blot or immunofluorescence

    • Assess cellular localization using confocal microscopy

Research methodological approach: A factorial design experiment testing multiple parameters simultaneously (cell density, DNA amount, reagent volume, incubation time) can efficiently identify optimal transfection conditions for specific fish cell lines.

What approaches can be used to study the role of lunapark-B in endoplasmic reticulum stress response in Takifugu rubripes?

Investigating the role of lunapark-B in ER stress response in Takifugu rubripes can be approached through several complementary methods:

  • In vitro induction of ER stress:

    • Treat cell cultures with tunicamycin, thapsigargin, or DTT

    • Expose cells to environmental stressors like hypoxia

    • Monitor lunapark-B expression changes via qPCR and Western blot

  • ER morphology analysis:

    • Visualize ER structure using ER-targeted fluorescent proteins

    • Employ high-resolution microscopy (confocal, super-resolution)

    • Quantify changes in ER tubule density, junction formation, and sheet area

  • Functional studies:

    • Overexpress or knock down lunapark-B and assess impact on ER stress markers

    • Monitor unfolded protein response (UPR) pathway activation

    • Evaluate cell survival under ER stress conditions with modified lunapark-B levels

Research methodological approach: RNA-seq analysis of cells with modified lunapark-B expression under normal and ER stress conditions can reveal global transcriptional changes, similar to approaches used in hypoxia studies of Takifugu rubripes . This can identify pathways and genes that interact with lunapark-B during ER stress responses.

How might comparative genomic approaches enhance our understanding of lunapark-B evolution in Takifugu species?

Comparative genomic approaches can significantly advance our understanding of lunapark-B evolution in Takifugu species through:

  • Evolutionary analysis:

    • Compare lnpb gene sequences across Takifugu species (T. rubripes, T. chinensis, T. pseudommus)

    • Calculate selection pressures (dN/dS ratios) on different domains of the protein

    • Identify conserved regulatory elements in promoter regions

  • Structural genomic comparisons:

    • Analyze chromosomal context and synteny of the lnpb gene

    • Identify species-specific variations in exon-intron structure

    • Examine copy number variations and potential gene duplications

  • Integration with phenotypic data:

    • Correlate genetic variations with differences in ER morphology

    • Analyze expression patterns in relation to species-specific adaptations

    • Investigate potential roles in species divergence

Research methodological approach: Next-generation sequencing combined with phylogenetic analysis can reveal the evolutionary history of lunapark-B in Takifugu species. This approach has been successfully applied to study genetic relationships among different Takifugu species, revealing important insights about their speciation processes .

What role might lunapark-B play in the hypoxia response of Takifugu rubripes?

Given that the brain of Takifugu rubripes shows significant transcriptional changes under hypoxic conditions , investigating the potential role of lunapark-B in hypoxia response presents a promising research direction:

  • Expression analysis under hypoxia:

    • Measure lunapark-B mRNA and protein levels at different timepoints during hypoxia exposure

    • Compare expression patterns across tissues with varying oxygen sensitivity

    • Correlate with known hypoxia response markers (HIF-1α, VEGF)

  • ER stress and hypoxia connection:

    • Investigate whether hypoxia-induced ER stress affects lunapark-B function

    • Analyze changes in ER morphology during hypoxia and the role of lunapark-B

    • Examine interactions between lunapark-B and hypoxia-responsive proteins

  • Functional significance:

    • Assess the impact of lunapark-B knockdown or overexpression on cellular survival during hypoxia

    • Determine whether lunapark-B is involved in metabolic adaptations to low-oxygen conditions

    • Evaluate potential protective mechanisms against hypoxia-induced damage

Research methodological approach: ChIP-seq analysis targeting hypoxia-inducible factors could reveal whether lunapark-B is directly regulated by the hypoxia response pathway. Additionally, proteomics approaches can identify changes in lunapark-B interactome under hypoxic conditions.

How can high-throughput screening methods be applied to identify compounds that modulate lunapark-B function?

Developing high-throughput screening (HTS) approaches to identify modulators of lunapark-B function could advance both basic understanding and potential applications:

  • Assay development:

    • Design reporter systems linking lunapark-B activity to measurable outputs

    • Establish cell-based screens monitoring ER morphology changes

    • Develop in vitro assays measuring direct binding or enzymatic activity

  • Compound library selection:

    • Natural product collections, particularly from marine sources

    • Focused libraries targeting membrane proteins or zinc finger domains

    • Repurposing screens using approved drugs

  • Validation workflow:

    • Secondary assays confirming specificity for lunapark-B

    • Dose-response studies determining potency

    • Mechanistic studies revealing mode of action

  • Application in research:

    • Use identified compounds as chemical probes to study lunapark-B function

    • Develop tools for temporal control of lunapark-B activity

    • Investigate structure-activity relationships to design improved modulators

Research methodological approach: A combination of phenotypic screening measuring ER network formation and target-based approaches assessing compound binding to purified recombinant lunapark-B would provide complementary insights into potential modulators of this protein's function.

How can researchers address solubility issues when expressing recombinant Takifugu rubripes Protein lunapark-B?

Solubility challenges are common when expressing membrane-associated proteins like lunapark-B. Based on experiences with other recombinant fish proteins , researchers can implement the following strategies:

  • Expression system modifications:

    • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Lower induction temperature (16-18°C) to slow protein folding

    • Reduce inducer concentration and extend expression time

  • Fusion tag approaches:

    • Beyond His-tag, test solubility-enhancing tags (MBP, SUMO, GST)

    • Position tags at N-terminus or C-terminus to determine optimal arrangement

    • Include TEV or PreScission protease sites for tag removal

  • Solubilization and refolding strategies:

    • If inclusion bodies form, optimize solubilization with different denaturants

    • Test various refolding methods (dilution, dialysis, on-column refolding)

    • Incorporate appropriate additives (L-arginine, glycerol, detergents)

Research methodological approach: A systematic approach testing multiple variables simultaneously using design of experiments (DoE) methodology can efficiently identify optimal conditions for soluble protein expression. Similar approaches have been successful for other recombinant proteins from Takifugu rubripes .

What strategies can improve the yield of functional recombinant Takifugu rubripes Protein lunapark-B?

Improving the yield of functional lunapark-B protein requires consideration of both expression and purification parameters:

  • Genetic optimization:

    • Codon optimization for E. coli expression

    • Removal of rare codons or secondary structure in mRNA

    • Expression of domain-specific constructs if full-length protein is problematic

  • Culture condition optimization:

    • Test different media formulations (LB, TB, autoinduction)

    • Optimize cell density at induction

    • Supplement with cofactors (zinc for zinc finger domain)

  • Purification refinement:

    • Optimize buffer compositions to maintain protein stability

    • Test different affinity resins and elution conditions

    • Include stabilizing agents throughout purification process

Based on similar recombinant proteins from Takifugu rubripes, yields of 50-100 mg from 5L fermentation culture may be achievable under optimized conditions .

Research methodological approach: Process analytical technology (PAT) approaches monitoring critical parameters during fermentation can guide real-time adjustments to maximize protein yield and quality. Additionally, high-throughput small-scale expression screening can identify promising conditions before scaling up.

How can proteomics and transcriptomics be combined to study lunapark-B function in Takifugu rubripes?

Integrating proteomics and transcriptomics provides a comprehensive approach to understand lunapark-B function:

  • Multi-omics experimental design:

    • Collect matched samples for both RNA and protein extraction

    • Include multiple tissue types and experimental conditions

    • Plan for appropriate biological and technical replicates

  • Transcriptomic approaches:

    • RNA-seq to identify co-expressed genes and regulatory networks

    • Alternative splicing analysis to detect isoform variations

    • Long-read sequencing to resolve complex gene structures

  • Proteomic strategies:

    • Shotgun proteomics for global protein identification

    • Targeted proteomics (PRM/MRM) for quantitative analysis of lunapark-B

    • Phosphoproteomics to detect post-translational modifications

  • Integrated analysis:

    • Correlation analysis between transcript and protein levels

    • Pathway enrichment incorporating both datasets

    • Network analysis to identify functional modules

Research methodological approach: Similar to studies on DNA methylation and gene expression in Takifugu rubripes , multi-omics integration can reveal regulatory mechanisms and functional relationships not apparent from single-omics approaches alone.

What advanced computational methods can help predict functional domains in Takifugu rubripes Protein lunapark-B?

Advanced computational methods can provide valuable insights into the functional domains of lunapark-B:

  • Sequence-based prediction:

    • Profile hidden Markov models for domain identification

    • Machine learning approaches for feature prediction

    • Evolutionary coupling analysis to identify co-evolving residues

  • Structure prediction tools:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Molecular dynamics simulations to assess conformational dynamics

    • Protein-protein docking to predict interaction interfaces

  • Comparative analysis:

    • Ortholog identification across species

    • Conservation mapping onto predicted structures

    • Identification of functionally important residues

  • Functional annotation:

    • Gene Ontology (GO) term prediction

    • Protein-protein interaction network analysis

    • Pathway enrichment to identify biological processes

Research methodological approach: Integration of multiple computational predictions with experimental validation provides the most robust analysis. For example, predicted functional residues can be tested through site-directed mutagenesis and functional assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.