Recombinant Takifugu rubripes Putative protein 2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
Putative protein 2; PUT2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
Target Protein Sequence
MPSDREGLWMLAAFALMTLFLLDNVGVTQAKSFDDVRCKCICPPYRNISGHIYNRNFTQK DCNCLHVVDPMPVPGNDVEAYCLLCECKYEERSTNTIRVTIIIFLSVVGALLLYMLFLLL VDPLIRKPDPLAQTLHNEEDSEDIQPQMSGDPARGNTVLERVEGAQQRWKKQVQEQRKTV FDRHKML
Uniprot No.

Target Background

Protein Families
TMEM9 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Takifugu rubripes Putative protein 2 and what is its significance in research?

Takifugu rubripes Putative protein 2 (PUT2) is a 187-amino acid protein derived from the Japanese pufferfish (Fugu rubripes) with UniProt ID O73698. While its precise physiological function remains under investigation, researchers use this protein to study comparative biology and protein evolution in marine species. The protein contains several characteristic domains including potential transmembrane regions and signal peptides that suggest membrane-associated functions. The study of PUT2 contributes to our understanding of protein diversity across vertebrate lineages and provides insights into specialized protein adaptations in marine environments. The amino acid sequence suggests potential functional roles in cell signaling or transport mechanisms, though definitive functional characterization requires further investigation .

What expression systems are most effective for producing recombinant Takifugu rubripes Putative protein 2?

The most effective and widely utilized expression system for recombinant Takifugu rubripes Putative protein 2 is Escherichia coli with N-terminal histidine tagging. This bacterial expression system provides several advantages including rapid growth, high protein yields, and established purification protocols. The E. coli system has been successfully employed to produce the full-length protein (1-187aa) in sufficient quantities for downstream applications and structural studies .

When using E. coli, researchers should consider the following methodological approaches:

  • Using BL21(DE3) strain derivatives for tight expression control

  • Optimizing induction conditions (temperature, IPTG concentration, induction time)

  • Co-expressing molecular chaperones to improve solubility

  • Employing fusion tags beyond His-tag (such as GST or MBP) if solubility issues arise

Alternative expression systems worth considering include:

  • Yeast systems (Pichia pastoris) for proteins requiring eukaryotic post-translational modifications

  • Insect cell systems (Sf9, Sf21) for more complex folding requirements

What are the optimal storage and handling conditions for recombinant Takifugu rubripes Putative protein 2?

Proper storage and handling are critical for maintaining the stability and activity of recombinant Takifugu rubripes Putative protein 2. Based on established protocols, the following conditions are recommended:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C/-80°CAliquoting necessary to avoid repeated freeze-thaw cycles
Buffer compositionTris/PBS-based buffer, pH 8.0Contains 6% trehalose as stabilizer
Working aliquots4°CStable for up to one week
ReconstitutionDeionized sterile waterTo concentration of 0.1-1.0 mg/mL
Cryoprotectant5-50% glycerolRecommended final concentration of 50%
Physical formLyophilized powderCentrifuge vial before opening

For optimal results, researchers should avoid repeated freeze-thaw cycles as these significantly impact protein stability and activity. Working aliquots should be prepared when thawing frozen stocks to minimize degradation .

What experimental approaches are most effective for studying the function of Takifugu rubripes Putative protein 2?

Investigating the function of Takifugu rubripes Putative protein 2 requires a multi-faceted experimental approach. Based on research with similar proteins from fish species, the following methodological strategies are recommended:

Binding and Interaction Studies:

  • Ultrafiltration binding assays to identify potential ligands, similar to those used with pufferfish saxitoxin and tetrodotoxin binding proteins

  • Surface plasmon resonance (SPR) for real-time binding kinetics analysis

  • Pull-down assays using the His-tag for identification of protein-protein interaction partners

Structural Characterization:

  • Circular dichroism (CD) spectroscopy to determine secondary structure composition, as performed with pufferfish leptin

  • Nuclear magnetic resonance (NMR) spectroscopy for three-dimensional structure determination

  • X-ray crystallography for high-resolution structural analysis

Functional Analysis:

  • Cell-based assays using transfected cell lines to assess biological activity

  • In vitro enzymatic assays if catalytic activity is suspected

  • Gene knockout or knockdown studies in model organisms to determine physiological role

Expression Pattern Analysis:

  • Quantitative PCR to measure tissue-specific expression patterns

  • RNA-seq for comprehensive transcriptomic profiling

  • Western blotting using anti-His antibodies to detect protein expression in various tissues

How can researchers address solubility and folding challenges with recombinant Takifugu rubripes Putative protein 2?

Solubility and proper folding present significant challenges when working with recombinant fish proteins. Drawing from experiences with other Takifugu rubripes proteins, researchers should consider the following approaches:

Co-expression with Chaperones:

  • Co-express with E. coli chaperone proteins (GroEL/GroES, DnaK/DnaJ/GrpE) to improve soluble yield

  • Dual plasmid systems allow for tunable chaperone expression alongside the target protein

Optimization of Expression Conditions:

  • Reduce induction temperature (16-20°C) to slow translation and improve folding

  • Use lower inducer concentrations and longer induction times

  • Test various E. coli strains optimized for membrane or difficult-to-express proteins

Solubilization and Refolding Strategies:

  • If inclusion bodies form, develop a stepwise refolding protocol using decreasing concentrations of chaotropic agents

  • Include additives such as L-arginine, glycerol, or non-detergent sulfobetaines during refolding

  • Employ on-column refolding techniques utilizing the His-tag

Buffer Optimization:

  • Screen multiple buffer compositions (pH, ionic strength, additives)

  • Include stabilizing agents such as trehalose as used in commercial preparations

  • Use mild detergents for membrane-associated domains

A systematic approach to troubleshooting solubility issues is recommended, as seen in this decision tree for recombinant protein production:

ProblemPrimary StrategyAlternative StrategyFinal Resort
Insoluble expressionLower temperature, reduce inducerCo-express chaperonesDenature and refold
Improper foldingAdd stabilizing agentsTry fusion partnersScreen folding conditions
AggregationInclude arginine or trehaloseTest different pH rangesSize exclusion chromatography
Low expressionCodon optimizationChange promoter systemSwitch expression host

What approaches are recommended for analyzing post-translational modifications of Takifugu rubripes Putative protein 2?

Post-translational modifications (PTMs) can significantly impact protein function and are crucial to characterize in recombinant proteins. For Takifugu rubripes Putative protein 2, the following analytical approaches are recommended:

Mass Spectrometry-Based Methods:

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for comprehensive PTM mapping

  • MALDI-TOF MS for rapid screening of major modifications

  • Electron transfer dissociation (ETD) MS for analysis of labile modifications

Site-Specific Characterization:

  • Phosphorylation analysis using phospho-specific antibodies or Phos-tag SDS-PAGE

  • Glycosylation assessment using glycosidase treatments followed by mobility shift analysis

  • Site-directed mutagenesis of predicted modification sites to determine functional importance

Comparative Analysis:

  • Compare PTMs between recombinant protein and native protein isolated from Takifugu rubripes tissues

  • Assess differences in PTMs between bacterial and eukaryotic expression systems

While E. coli-expressed proteins lack many eukaryotic PTMs, understanding which modifications are absent in the recombinant protein is essential for accurate functional characterization. If specific PTMs are crucial for function, researchers should consider eukaryotic expression systems .

What are the most effective approaches for studying structure-function relationships in Takifugu rubripes Putative protein 2?

Establishing structure-function relationships for Takifugu rubripes Putative protein 2 requires integrating structural biology with functional assays. Based on successful approaches with other pufferfish proteins, the following methodologies are recommended:

Structural Analysis:

  • Circular dichroism (CD) spectroscopy to characterize secondary structure elements, as successfully applied to pufferfish leptin

  • Nuclear magnetic resonance (NMR) spectroscopy for solution structure determination

  • X-ray crystallography for high-resolution structural information

  • In silico structural prediction and molecular dynamics simulations

Functional Domain Mapping:

  • Generation of truncation mutants to identify functional domains

  • Site-directed mutagenesis of conserved residues for structure-function correlation

  • Domain swapping with homologous proteins to determine domain-specific functions

Binding Site Identification:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map ligand binding interfaces

  • Molecular docking simulations to predict binding sites

  • Chemical cross-linking coupled with mass spectrometry to identify interaction interfaces

Comparative Analysis:

  • Homology modeling based on structurally characterized proteins from other species

  • Evolutionary trace analysis to identify functionally important conserved residues

  • Comparison with similar proteins that have established functions, such as the tetrodotoxin binding proteins in Takifugu rubripes

How can researchers overcome challenges in functional characterization of Takifugu rubripes Putative protein 2?

Functional characterization of novel proteins like Takifugu rubripes Putative protein 2 presents several challenges. Based on experiences with similar pufferfish proteins, researchers should consider the following strategies:

Addressing Knowledge Gaps:

  • Perform comparative genomics analysis to identify putative functions based on sequence similarity

  • Use gene co-expression networks to identify functionally related proteins

  • Employ phylogenetic profiling to determine evolutionary conservation patterns

Developing Relevant Assays:

  • Design assays based on predicted functions from bioinformatic analysis

  • Test multiple potential functions in parallel rather than sequentially

  • Establish cell-based reporter systems to monitor potential signaling activities

Overcoming Technical Limitations:

  • Use heterologous expression systems that maintain functional activity

  • Develop antibodies or tagged constructs for tracking localization and interactions

  • Employ CRISPR/Cas9 gene editing in fish cell lines to study loss-of-function phenotypes

Creating Physiologically Relevant Conditions:

  • Perform functional studies under conditions that mimic the marine environment

  • Consider temperature, pH, and salt concentration effects on protein function

  • Test functionality in the presence of tissue extracts from Takifugu rubripes

What computational methods and tools are most useful for analyzing Takifugu rubripes Putative protein 2?

Computational approaches provide valuable insights when experimental data is limited. For Takifugu rubripes Putative protein 2, the following in silico methods are recommended:

Sequence Analysis:

  • Multiple sequence alignment with homologs to identify conserved motifs

  • Domain prediction using tools like SMART, Pfam, and InterPro

  • Signal peptide and transmembrane domain prediction using SignalP and TMHMM

Structural Prediction:

  • Ab initio structure prediction using Rosetta or AlphaFold

  • Template-based modeling using I-TASSER or SWISS-MODEL

  • Molecular dynamics simulations to assess structural stability and flexibility

Function Prediction:

  • Gene Ontology (GO) term assignment based on sequence similarity

  • Protein-protein interaction prediction using STRING or PrePPI

  • Ligand binding site prediction using CASTp or FTSite

Genomic Context Analysis:

  • Comparative genomics to identify syntenic regions across species

  • Promoter analysis for transcription factor binding sites

  • Analysis of gene neighborhood conservation

These computational approaches should be used to generate testable hypotheses that guide experimental design, creating an iterative process between computational prediction and experimental validation.

What are the current methodological approaches for studying protein-protein interactions involving Takifugu rubripes Putative protein 2?

Understanding protein-protein interactions is crucial for elucidating the biological function of Takifugu rubripes Putative protein 2. Based on approaches used with similar proteins, the following methodologies are recommended:

In Vitro Interaction Methods:

  • Pull-down assays using His-tagged Putative protein 2 as bait

  • Surface plasmon resonance (SPR) for measuring binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic characterization of interactions

  • Biolayer interferometry for real-time interaction analysis

Cell-Based Interaction Methods:

  • Yeast two-hybrid screening to identify novel interaction partners

  • Mammalian two-hybrid systems for verification in a more complex cellular environment

  • Bimolecular fluorescence complementation (BiFC) for visualizing interactions in living cells

  • Proximity labeling approaches (BioID, APEX) to capture transient interactions

Proteomics Approaches:

  • Co-immunoprecipitation followed by mass spectrometry

  • Cross-linking mass spectrometry to map interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry to identify binding-induced conformational changes

Computational Prediction:

  • Protein-protein docking simulations

  • Coevolutionary analysis to identify co-evolving residues at interaction interfaces

  • Network analysis to predict functional interaction partners based on genomic context

When designing interaction studies, researchers should consider the potential membrane association of Putative protein 2 and include appropriate detergents or membrane mimetics in their experimental design to maintain the protein's native conformation.

What are the future research directions for Takifugu rubripes Putative protein 2?

The study of Takifugu rubripes Putative protein 2 offers several promising research avenues that could significantly advance our understanding of fish protein biology and evolution. Future research directions should focus on:

Functional Characterization:

  • Comprehensive determination of physiological roles through knockout studies in model fish systems

  • Investigation of potential roles in toxin binding, similar to other pufferfish proteins

  • Exploration of evolutionary significance through comparative studies across fish species

Structural Biology:

  • High-resolution structure determination using advanced techniques such as cryo-electron microscopy

  • Mapping of functional domains and binding interfaces

  • Structure-based drug design for compounds targeting homologous proteins in other species

Biotechnological Applications:

  • Exploration of potential applications in biosensing or bioremediation

  • Development as a potential research tool for studying membrane proteins

  • Investigation of immunological properties and potential diagnostic applications

Evolutionary Studies:

  • Comprehensive phylogenetic analysis to trace the evolution of this protein family

  • Investigation of selection pressures that shaped the protein's structure and function

  • Comparative genomics to understand gene duplication and divergence patterns

By pursuing these research directions, scientists can build a more complete understanding of Takifugu rubripes Putative protein 2 and its significance in the biology of marine organisms.

What are the key methodological challenges that remain unsolved in the study of Takifugu rubripes Putative protein 2?

Despite advances in protein science, several methodological challenges persist in the study of Takifugu rubripes Putative protein 2:

Expression and Purification:

  • Obtaining sufficient quantities of properly folded protein remains difficult

  • Developing expression systems that incorporate relevant post-translational modifications

  • Establishing purification protocols that maintain native structure and function

Structural Characterization:

  • Obtaining crystals suitable for X-ray diffraction studies

  • Overcoming challenges in NMR spectroscopy related to protein size and stability

  • Resolving membrane-associated domains in their native conformation

Functional Analysis:

  • Developing specific assays to test hypothesized functions

  • Creating appropriate in vitro systems that mimic the protein's native environment

  • Establishing animal models for in vivo functional studies

Physiological Relevance:

  • Connecting biochemical findings to physiological roles in the organism

  • Understanding tissue-specific functions and regulation

  • Establishing the protein's role in the broader context of fish physiology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.