Recombinant Takifugu rubripes Sphingosine 1-phosphate receptor 3 (s1pr3)

Shipped with Ice Packs
In Stock

Description

Sphingosine 1-phosphate Receptor Family

Sphingosine 1-phosphate receptors (S1PRs) constitute a family of G protein-coupled receptors that specifically bind the bioactive lipid mediator sphingosine 1-phosphate (S1P). These receptors are categorized within the class of lysophospholipid receptors and play crucial roles in diverse physiological processes . The S1PR family contains five members, designated S1PR1-5, each with distinctive tissue distribution patterns and signaling properties . Among these, S1PR3 has gained attention for its involvement in various cellular processes, including inflammation regulation, cell survival, and extracellular matrix maintenance .

Takifugu rubripes as a Model Organism

Takifugu rubripes, commonly known as the Japanese pufferfish or Fugu rubripes, has emerged as an important model organism in comparative genomics and molecular biology . This species offers valuable insights into vertebrate evolution and protein function due to its compact genome while maintaining a gene repertoire similar to that of mammals. The S1PR3 protein from this organism serves as an excellent subject for studying the structure-function relationships of GPCRs across evolutionary distances .

Recombinant Protein Technology

The recombinant Takifugu rubripes S1PR3 protein is produced through heterologous expression in Escherichia coli systems . This approach allows for controlled production and purification of the target protein for research applications. The addition of a histidine (His) tag to the N-terminus facilitates purification through affinity chromatography, enabling isolation of the protein with high purity for subsequent structural and functional studies .

Secondary and Tertiary Structure

As a member of the GPCR superfamily, the Takifugu rubripes S1PR3 protein adopts a characteristic seven-transmembrane (7TM) helical structure that spans the cell membrane . According to the SWISS-MODEL Repository, there exists a structural model based on the template 7ew3.1.D with a QMEAN score of 0.75, indicating a reasonable quality prediction . This model represents the protein in a monomeric state.

The three-dimensional structure features the typical GPCR architecture with:

  • An extracellular N-terminal domain

  • Seven transmembrane (TM) helices

  • Three extracellular loops

  • Three intracellular loops

  • A potential eighth helix near the C-terminus

  • An intracellular C-terminal domain

Expression and Purification Methods

The recombinant Takifugu rubripes S1PR3 protein is produced using an E. coli expression system, which provides advantages in terms of high yield and scalability . The full-length protein (residues 1-384) is fused to an N-terminal His-tag, facilitating purification through affinity chromatography methods. The product specification indicates the protein achieves greater than 90% purity as determined by SDS-PAGE analysis .

Physical and Chemical Properties

The recombinant Takifugu rubripes S1PR3 exhibits the following biochemical characteristics:

PropertyDescription
FormLyophilized powder
Molecular Weight~43 kDa (estimated based on amino acid sequence)
TagN-terminal His-tag
Purity>90% by SDS-PAGE
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
Protein LengthFull Length (1-384 amino acids)

The inclusion of trehalose in the storage buffer serves as a cryoprotectant that prevents protein denaturation during freeze-thaw cycles .

Signaling Mechanisms

As a G protein-coupled receptor, Takifugu rubripes S1PR3 functions by binding sphingosine 1-phosphate and activating various downstream signaling pathways. While the exact signaling mechanisms of the Takifugu rubripes variant have not been thoroughly characterized in the available literature, insights can be drawn from studies on mammalian S1PR3 and related receptors . The receptor likely couples to multiple G protein subtypes, including Gi, Gq, and G12/13, to mediate diverse cellular responses.

Anti-inflammatory Properties

Research on S1PR3 indicates significant anti-inflammatory functions. Studies have shown that S1PR3 expression is reduced in lipopolysaccharide (LPS)-induced inflammatory conditions, while overexpression of S1PR3 inhibits the production of pro-inflammatory cytokines, including TNF-α, IL-1β, and IL-6 . These findings suggest that S1PR3 plays a critical role in modulating inflammatory responses, potentially through regulation of TLR2-mediated signaling pathways .

Cell Viability and Anti-apoptotic Effects

S1PR3 has been implicated in promoting cell survival and inhibiting apoptosis. Evidence indicates that S1PR3 overexpression increases cell viability in human nucleus pulposus cells (HNPCs) . This protective effect is associated with changes in the expression of apoptosis-related proteins, with S1PR3 overexpression leading to increased levels of the anti-apoptotic protein Bcl-2 and decreased levels of the pro-apoptotic protein Bax .

Extracellular Matrix Regulation

A significant function of S1PR3 involves the regulation of extracellular matrix (ECM) composition. Research demonstrates that S1PR3 overexpression modulates the expression of ECM-related proteins with notable effects:

ECM-Related ProteinsEffect of S1PR3 Overexpression
ADAMTS-4Decreased expression
ADAMTS-5Decreased expression
MMP3Decreased expression
MMP13Decreased expression
AggrecanIncreased expression
Collagen IIIncreased expression

These effects suggest a role for S1PR3 in maintaining ECM integrity, which is critical for tissue structure and function .

Pathway Interactions

S1PR3 interacts with multiple signaling pathways, particularly the STAT3 and MAPK pathways . Studies have shown that S1PR3 overexpression inhibits the phosphorylation of STAT3, JNK, ERK, and p38, suggesting a regulatory role in these signaling cascades. Interestingly, the effects of S1PR3 on cell viability, apoptosis, inflammation, and ECM degradation are partially offset by TLR2 overexpression, indicating a complex interplay between these receptors and their respective signaling networks .

Comparative Evolutionary Research

As a protein from a non-mammalian vertebrate, Takifugu rubripes S1PR3 offers opportunities for comparative and evolutionary studies of S1P receptors across different species . The compact genome of Takifugu rubripes, combined with its evolutionary position, makes it a valuable model for understanding the ancestral functions and subsequent diversification of S1P receptors in vertebrates.

Comparative analyses of S1PR3 sequences, structures, and functions across species can provide insights into:

  • Conservation of essential functional domains

  • Evolution of species-specific adaptations

  • Diversification of signaling mechanisms

  • Structural adaptations to different cellular environments

Therapeutic Target Development

While the direct therapeutic applications of the Takifugu rubripes S1PR3 protein itself may be limited, the insights gained from its study can inform the development of therapeutics targeting human S1PR3 and related receptors. The identified anti-inflammatory, pro-survival, and ECM-regulatory functions attributed to S1PR3 suggest potential therapeutic avenues for conditions involving inflammation, cellular damage, and ECM degradation .

Moreover, structural information derived from the Takifugu rubripes S1PR3 protein can aid in the rational design of drugs targeting human S1P receptors, potentially leading to more selective and effective therapeutic agents for conditions such as inflammatory diseases where S1P receptor modulators have demonstrated clinical utility .

Limitations in Current Research

Despite the advances in understanding Takifugu rubripes S1PR3, several limitations exist in the current research landscape:

  1. Limited direct functional studies specifically on the Takifugu rubripes variant

  2. Challenges in expressing and maintaining proper folding of membrane proteins in prokaryotic systems

  3. Potential differences in post-translational modifications between prokaryotic expression systems and the native environment

  4. The complexity of GPCR signaling networks, which can make it difficult to isolate specific receptor functions

Future Research Directions

Several promising research directions could enhance our understanding of Takifugu rubripes S1PR3:

  1. High-resolution structural determination through crystallography or cryo-electron microscopy

  2. Comparative functional studies with S1PR3 from other species to elucidate evolutionary conservation and divergence

  3. Investigation of species-specific ligand binding properties and signaling mechanisms

  4. Development of tools for studying S1PR3 function in vivo in Takifugu rubripes

  5. Application of insights gained from the Takifugu rubripes S1PR3 to the design of therapeutics targeting human S1P receptors

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
s1pr3; edg3; Sphingosine 1-phosphate receptor 3; S1P receptor 3; S1P3; Sphingosine 1-phosphate receptor Edg-3; S1P receptor Edg-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
Target Names
Target Protein Sequence
MMINPLIYLHYNYTGKLDHRPTVGTSPGTRDPKTIAFLVVCSFIILENLTVLLAIWKNHR FHNRMYFFIGNLALCDLLASVAYLVNLLLSGEKTLQLSPVLWFVREGSMFVTLGASIFSL LAIAIERHLTMIKMRPYDASKNYRVFLLIGTCWLVAVLLGALPILGWNCLGNLPDCSTIL PLYTKKYVAFCIIVFIVLLLAMSVLYARIYILVKSSSQKVSKHRNSEHAMSLLRTVIIVV GVFIACWMPIFVLLLLDVACERPCPILYKADWFIAVAVLNSAMNPIIYTLASREMRRAFL GLVCGVCYRGNGSGNDSGNKQFQEPSRSRSKSWSSQTHPNQSQQSSRPAELDREQETGHG EISVVAGGAAQASQREGEGGNGGR
Uniprot No.

Target Background

Function
This protein is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P).
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.