Recombinant Takifugu rubripes Surfeit locus protein 4 (surf4)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant Takifugu rubripes Surf4 is produced in vitro with the following specifications:

PropertyDetails
UniProt IDO57590
Expression RegionAmino acids 1–269 (full-length protein)
TagDetermined during production (commonly His-tag or GST-fusion)
StorageTris-based buffer with 50% glycerol; store at -20°C or -80°C
Purity>85% (SDS-PAGE verified)
Sequence269 amino acids with multiple transmembrane domains

The protein contains conserved structural motifs critical for its role as a cargo receptor, including transmembrane regions and luminal domains that interact with ER-ESCAPE motifs (N-terminal tripeptides) on cargo proteins .

Functional Role in Secretory Pathways

Surf4 facilitates ER export of aggregation-prone proteins by binding to their N-terminal tripeptide motifs, ensuring efficient trafficking while preventing toxic aggregation . Key functions include:

  • Cargo Recognition: Binds ER-ESCAPE motifs (e.g., f-P-f) on proteins like proinsulin, PCSK9, and amelogenin .

  • Vesicle Packaging: Collaborates with COPII components (e.g., Sec24) to concentrate cargo into ER exit sites .

  • Disease Relevance: Overexpression linked to cancers and cardiovascular diseases; knockdown reduces plasma cholesterol and triglycerides in murine models .

Table 1: Experimental Use Cases for Recombinant Surf4

ApplicationFindings
Protein TraffickingSurf4 deletion disrupts ER-to-Golgi transport of proinsulin in β-cells .
Therapeutic TargetingSurf4 inhibition reduces atherosclerotic plaque formation in mice .
Structural StudiesLuminal domain of Surf4 interacts with Sec24A at the B-site .

This recombinant protein is instrumental in studying:

  • Mechanisms of ER quality control and ER-associated degradation (ERAD) .

  • Species-specific adaptations in secretory pathways (e.g., comparison with zebrafish Surf4) .

Table 2: Surf4 Homologs Across Species

SpeciesKey Features
Takifugu rubripesUsed in structural studies due to compact genome; 269-aa sequence .
Homo sapiensAssociates with ERGIC-53 and p24 proteins; regulates lipoprotein secretion .
Saccharomyces cerevisiaeErv29p homolog essential for α-factor pheromone packaging .

Challenges and Future Directions

  • Functional Redundancy: Partial compensation by Erv29p in Surf4-null systems complicates phenotypic analysis .

  • Therapeutic Potential: Small molecules like 4-PBA block Surf4-Sec24 interactions, suggesting druggability .

  • Unresolved Questions: Role in non-mammalian systems (e.g., Takifugu rubripes) remains underexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
surf4; Surfeit locus protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
Target Names
surf4
Target Protein Sequence
MGQEDLMNRAEDVADQFLRVTKQYLPHLARLCLISTFLEDGIRMWFQWNEQRDYIEATWS CGYFLATCFVLLNLIGQLGGCVLILSRNFVQYACFGLFGIIALQTVAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDFNFF SILQNLVGTALIILVAIGFKTKLAALTLVLWLLVINVYFNAFWTIPAYKPMHDFLKYDFF QTTSVIGGLLLVVALGPGGVSMDEKKKEW
Uniprot No.

Target Background

Function
Endoplasmic reticulum cargo receptor that mediates the export of lipoproteins by recruiting cargos into COPII vesicles to facilitate their secretion. It acts as a cargo receptor for lipoproteins bearing both APOB and APOA1, thereby regulating lipoprotein delivery and maintaining lipid homeostasis.
Database Links
Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How does Surf4 function differ between fish models and mammalian models?

While both fish and mammalian Surf4 proteins serve as cargo receptors in the early secretory pathway, there are notable functional differences:

FeatureFish Surf4 (Takifugu rubripes)Mammalian Surf4
Primary functionProtein trafficking between ER and GolgiProtein trafficking with additional roles in lipid metabolism
Known cargo specificityLimited research data availableShown to transport Shh (Sonic hedgehog) but not IGF2
Role in lipid metabolismUndetermined in fish modelsSignificantly reduces intestinal lipid absorption and chylomicron secretion
Tissue expressionGeneral expression pattern across tissuesHigh expression in enterocytes and hepatocytes

Methodologically, comparing functions requires careful experimental design using both recombinant proteins and knockout/knockdown approaches in respective model organisms. Researchers should consider using CRISPR-Cas9 gene editing in both fish and mammalian cell lines to establish comparative functional studies .

What expression and purification techniques are recommended for Takifugu rubripes Surf4?

Based on current protocols, the following methodology is recommended:

  • Expression system: E. coli expression systems have proven effective for recombinant Takifugu rubripes Surf4 production

  • Purification protocol:

    • Initial purification using affinity chromatography (His-tag or alternative tag depending on construct design)

    • Secondary purification via size exclusion chromatography

    • Confirmation of >85% purity using SDS-PAGE

  • Buffer optimization:

    • Tris-based buffer systems with 50% glycerol have shown optimal protein stability

    • Storage at -20°C or -80°C for extended preservation

  • Reconstitution guidelines:

    • Centrifuge vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

How can I design experiments to investigate Surf4's role in protein trafficking in fish models?

When investigating Surf4's role in protein trafficking in fish models such as Takifugu rubripes, consider this methodological framework:

  • Generation of trafficking assay systems:

    • Implement RUSH (Retention Using Selective Hooks) constructs similar to those used for ShhN trafficking studies in mammalian systems

    • Design fluorescently tagged Surf4 constructs for live-cell imaging studies

    • Establish fish cell lines with inducible Surf4 knockdown/knockout

  • Cargo identification approach:

    • Perform co-immunoprecipitation experiments with tagged Surf4 to identify binding partners

    • Use proximity labeling techniques (BioID or APEX) to identify proteins in close proximity to Surf4 in the secretory pathway

    • Compare results with known Surf4 interactors from mammalian studies (e.g., ShhN)

  • Functional validation:

    • Establish rescue experiments using wildtype and mutant Surf4 constructs

    • Quantify trafficking efficiency through pulse-chase experiments

    • Analyze secretome changes in Surf4-depleted cells using mass spectrometry

  • Visualization techniques:

    • Implement super-resolution microscopy to visualize Surf4 localization and trafficking dynamics

    • Use correlative light and electron microscopy (CLEM) to study ultrastructural changes

Successful research has employed combinations of these approaches to elucidate cargo-specific functions of Surf4 in related systems .

What are the challenges and solutions in expressing full-length transmembrane proteins like Surf4 for structural studies?

Challenges and Solutions in Structural Studies of Surf4

ChallengeSolutionMethodological Approach
Membrane protein solubilityDetergent screeningSystematic testing of detergents (DDM, LMNG, etc.) for extraction efficiency and protein stability
Protein aggregationFusion partnersAddition of solubility-enhancing tags (MBP, SUMO) with precision protease cleavage sites
Low expression yieldsExpression system optimizationTesting various expression systems (E. coli, insect cells, mammalian cells) and codon optimization for the selected system
Protein instabilityBuffer optimizationHigh-throughput buffer screening using differential scanning fluorimetry
Structural determinationCrystallization alternativesConsider single-particle cryo-EM or NMR for regions resistant to crystallization
  • Construct design optimization:

    • Create truncated constructs focusing on specific domains

    • Design constructs that remove flexible regions that might impede crystallization

    • Consider using thermostabilizing mutations based on computational predictions

  • Advanced purification techniques:

    • Implement GFP-fusion-based monitoring during expression and purification

    • Use fluorescence-detection size-exclusion chromatography (FSEC) to assess protein homogeneity

    • Consider lipid nanodiscs or amphipols for maintaining native-like membrane environment

The full-length sequence of Takifugu rubripes Surf4 contains multiple transmembrane domains, making it particularly challenging for structural studies without these specialized approaches .

How can comparative genomics be used to identify functional domains in Surf4 across different species?

Methodological Approach to Surf4 Comparative Genomics

  • Sequence acquisition and alignment:

    • Collect Surf4 sequences from diverse species including Takifugu rubripes, other fish species, and mammals

    • Generate multiple sequence alignments using tools like MUSCLE or MAFFT

    • Calculate conservation scores to identify highly conserved regions

  • Phylogenetic analysis:

    • Construct phylogenetic trees to understand evolutionary relationships

    • Apply methods similar to those used in studies of other Takifugu rubripes proteins

    • Use both maximum likelihood and Bayesian approaches for tree reconstruction

  • Domain prediction and analysis:

    • Identify transmembrane domains using predictive algorithms

    • Map conserved residues onto predicted structural models

    • Correlate conservation patterns with known functional data

  • Synteny analysis:

    • Examine genomic context of surf4 genes across species

    • Identify conserved gene neighborhoods that might indicate functional relationships

    • Use approaches similar to those employed for analyzing other gene families in Takifugu rubripes

Recent genomic analyses of Takifugu rubripes have revealed important insights about gene duplication and conservation patterns. For example, studies of the solute carrier family 11 (slc11) in Takifugu rubripes identified two paralogs with distinct evolutionary histories . Similar approaches can be applied to surf4 to identify functional domains conserved across species.

What methodologies are recommended for analyzing Surf4 protein-protein interactions in fish models?

Recommended Methodologies for Surf4 Protein-Protein Interaction Analysis

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged Surf4 in fish cell lines or tissues

    • Perform immunoprecipitation under various detergent conditions

    • Analyze interacting partners via LC-MS/MS

    • Implement SILAC or TMT labeling for quantitative comparison between conditions

  • Proximity-based labeling approaches:

    • Generate BioID or APEX2 fusion constructs with Surf4

    • Express in relevant fish cell lines

    • Identify proteins in close proximity through streptavidin pulldown and mass spectrometry

    • Compare interactome data with mammalian Surf4 studies

  • Yeast two-hybrid screening:

    • Use Surf4 domains as baits against fish cDNA libraries

    • Validate interactions through secondary assays

    • Map interaction domains through truncation constructs

  • Co-immunoprecipitation validation:

    • Design co-IP experiments to validate specific interactions

    • Use both overexpressed and endogenous proteins when possible

    • Implement controls similar to those used in studies of human Surf4-apoB48 interactions

  • Fluorescence-based interaction assays:

    • Implement FRET or split-GFP approaches for live-cell interaction studies

    • Use BiFC (Bimolecular Fluorescence Complementation) to visualize interactions in specific cellular compartments

Research on human Surf4 has demonstrated interaction with apoB48 in differentiated Caco-2 cells through co-immunoprecipitation . Similar methodologies can be adapted for studying Takifugu rubripes Surf4 interactions, with appropriate consideration for species-specific antibodies or expression systems.

What computational approaches can predict the impact of Surf4 mutations on protein function?

Computational Framework for Surf4 Mutation Analysis

  • Sequence-based predictive methods:

    • Implement SIFT, PolyPhen-2, and PROVEAN for initial mutation impact assessment

    • Use evolutionary conservation analysis to identify critical residues

    • Apply codon-based methods to detect signatures of selection

  • Structural prediction approaches:

    • Generate homology models using AlphaFold2 or RoseTTAFold

    • Perform molecular dynamics simulations of wild-type and mutant proteins

    • Calculate free energy changes upon mutation using FoldX or Rosetta

  • Functional domain analysis:

    • Map mutations to predicted functional domains (ER export signals, cargo binding sites)

    • Compare with known functional mutations in mammalian Surf4

    • Identify conservation patterns across the Surfeit protein family

  • Network analysis:

    • Integrate protein-protein interaction data

    • Assess potential disruption of interaction interfaces

    • Implement graph theory approaches to predict systemic effects

  • Machine learning integration:

    • Train ML models using known functional data from related proteins

    • Implement ensemble approaches combining multiple predictive methods

    • Validate predictions with targeted experimental assays

Based on studies of human Surf4, researchers have identified specific regions important for cargo recognition and ER export . These findings can guide the analysis of potential functional impacts of mutations in the Takifugu rubripes ortholog.

How does Surf4 compare functionally to other cargo receptors in the early secretory pathway?

Comparative Analysis of Surf4 and Other Cargo Receptors

FeatureSurf4ERGIC-53/LMAN1p24 FamilyTANGO1
Cargo specificityCertain secretory proteins (e.g., ShhN in mammals) Glycoproteins with mannose residuesSmall secretory cargoesLarge cargoes (e.g., collagen)
Trafficking directionER to GolgiER to ERGIC and GolgiBidirectional ER-GolgiER to Golgi
Recognition motifsNot fully characterized in fishHigh-mannose glycansHydrophobic/aromatic motifsUnknown for fish orthologs
Oligomeric stateNot fully characterizedHexamericHomo/heterooligomersMonomeric/dimeric
COPII interactionDirect COPII bindingCOPII binding via diphenylalanine motifCOPII bindingCOPII recruitment

To investigate functional differences between Surf4 and other cargo receptors in Takifugu rubripes:

  • Cargo spectrum analysis:

    • Perform comparative proteomics of secretomes in cells with individual cargo receptor knockdowns

    • Identify cargo specificities through direct binding assays

    • Compare sorting signals recognized by different receptors

  • Competition and cooperation assays:

    • Co-express multiple cargo receptors to assess potential cooperative or competitive interactions

    • Implement cargo trafficking assays under conditions of receptor overexpression or depletion

    • Analyze the effects of combinatorial knockdowns

  • Localization and dynamics studies:

    • Compare subcellular distribution and trafficking kinetics of different cargo receptors

    • Analyze response to secretory pathway stress

    • Assess recycling dynamics between compartments

Research on mammalian Surf4 has shown it functions as a cargo receptor for specific proteins like ShhN but not for others like IGF2 , suggesting specialized cargo recognition mechanisms that may be conserved in the Takifugu rubripes ortholog.

How has the Surf4 protein evolved among different pufferfish species (Takifugu family)?

Evolutionary Analysis of Surf4 in Pufferfish Species

The Takifugu genus comprises approximately 25 species that have undergone explosive speciation in marine environments of East Asia . Comparative analysis of Surf4 evolution within this genus provides insights into protein conservation and potential functional adaptations.

Methodological approach:

  • Sequence collection and alignment:

    • Extract Surf4 coding sequences from available Takifugu genomes including T. rubripes, T. pseudommus, and T. chinensis

    • Generate codon-aware alignments to preserve reading frame information

    • Calculate sequence identity and similarity metrics across species

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify signatures of purifying or positive selection

    • Implement site-specific and branch-specific models to detect episodic selection

    • Compare selection patterns with other Surfeit family proteins

  • Structural comparison:

    • Predict protein structures across species using homology modeling

    • Identify structurally conserved regions that may be functionally important

    • Map sequence variations onto structural models

  • Expression pattern comparison:

    • Analyze available transcriptomic data to compare expression profiles across species

    • Identify potential regulatory differences in surf4 gene expression

    • Correlate expression patterns with ecological or physiological adaptations

Recent genomic analyses of Takifugu species have revealed complex evolutionary relationships , providing a foundation for species-specific Surf4 studies. The close genetic relationship between T. rubripes, T. pseudommus, and T. chinensis suggests high conservation of functional proteins including Surf4 .

What techniques are most effective for studying the role of Surf4 in fish development?

Methodological Framework for Studying Surf4 in Fish Development

  • Temporal and spatial expression analysis:

    • Implement whole-mount in situ hybridization to map surf4 expression during embryonic development

    • Use quantitative RT-PCR to measure expression levels across developmental stages

    • Apply single-cell RNA-seq to identify cell type-specific expression patterns

  • Loss-of-function approaches:

    • Generate CRISPR/Cas9 knockout models in suitable fish species (zebrafish if Takifugu is not practical)

    • Design morpholino oligonucleotides for transient knockdown

    • Implement conditional knockout systems for stage-specific Surf4 deletion

  • Gain-of-function approaches:

    • Create mRNA overexpression constructs for microinjection

    • Develop transgenic lines with tissue-specific or inducible Surf4 expression

    • Design rescue experiments with wild-type and mutant Surf4 variants

  • Phenotypic analysis:

    • Conduct comprehensive morphological assessment at different developmental stages

    • Implement live imaging to track developmental processes in real-time

    • Perform lineage tracing in Surf4-deficient backgrounds

  • Molecular pathway analysis:

    • Analyze effects on secretory pathway organization using ER/Golgi markers

    • Assess impact on signaling pathway components that require secretion

    • Implement transcriptomic and proteomic analyses to identify affected developmental programs

Studies on other Takifugu rubripes proteins have employed similar developmental approaches , which can be adapted for Surf4 functional studies. For example, research on tiger puffer (Takifugu rubripes) growth has utilized recombinant hormone analysis that could be adapted to study Surf4's developmental roles .

How do the immunological properties of Surf4 compare between fish and mammals?

Applications of Recombinant Surf4 in Trafficking Research

  • Cargo sorting assays:

    • Use purified recombinant Surf4 in binding assays to identify potential cargo molecules

    • Implement in vitro vesicle budding assays with reconstituted components

    • Develop competition assays to map binding specificities and affinities

  • Structural studies of trafficking complexes:

    • Utilize recombinant Surf4 for co-crystallization with binding partners

    • Implement single-particle cryo-EM studies of Surf4-cargo complexes

    • Perform hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Antibody development:

    • Generate specific antibodies against Takifugu rubripes Surf4

    • Use these antibodies for immunolocalization and trafficking studies

    • Implement immunodepletion approaches to study Surf4-dependent trafficking

  • Interspecies complementation studies:

    • Express Takifugu rubripes Surf4 in mammalian Surf4-knockout cells

    • Assess functional complementation and cargo specificity

    • Identify conserved and divergent mechanisms

The recombinant protein is available with >85% purity , making it suitable for these applications. Researchers should optimize reconstitution conditions using deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for stability .

What are the most reliable methods for detecting endogenous Surf4 expression in fish tissues and cells?

Methodological Approaches for Endogenous Surf4 Detection

  • Transcript-level detection:

    • Design specific primers for qRT-PCR targeting surf4 mRNA

    • Implement in situ hybridization for spatial localization

    • Use RNA-seq for comprehensive expression profiling

  • Protein-level detection:

    • Generate specific antibodies against Takifugu rubripes Surf4

    • Validate antibody specificity using knockout/knockdown controls

    • Optimize western blot conditions for membrane protein detection

    • Implement immunohistochemistry protocols for tissue sections

  • Reporter systems:

    • Generate CRISPR knock-in lines with fluorescent tags at the endogenous surf4 locus

    • Create BAC transgenic lines containing the surf4 gene with its native regulatory elements

    • Develop promoter-reporter constructs for transcriptional activity studies

  • Mass spectrometry approaches:

    • Implement targeted proteomics (SRM/MRM) for sensitive detection

    • Use enrichment strategies for membrane proteins prior to MS analysis

    • Develop specific peptide standards for absolute quantification

Studies of other proteins in Takifugu rubripes have successfully employed RT-PCR and immunological techniques for expression analysis . For example, research on CD4+ cells in Japanese pufferfish utilized specific antibodies and expression analysis of cell marker genes , which could serve as a methodological template for Surf4 studies.

How can researchers address contradictory data in Surf4 functional studies between different model systems?

Strategies for Resolving Contradictory Experimental Results

When confronted with contradictory data regarding Surf4 function between different model systems (e.g., fish vs. mammalian), researchers should implement the following methodological framework:

  • Systematic comparison of experimental conditions:

    • Create a detailed table documenting all relevant experimental parameters from contradictory studies

    • Identify potential confounding variables (temperature, pH, cell types, expression levels)

    • Design experiments that systematically test the impact of these variables

  • Standardized reagents and protocols:

    • Implement identical constructs across different model systems

    • Use the same antibodies and detection methods where possible

    • Document detailed protocols to enable perfect replication

  • Cross-validation approaches:

    • Apply multiple complementary techniques to address the same question

    • Implement orthogonal assays that measure different aspects of the same process

    • Use both gain-of-function and loss-of-function approaches

  • Evolutionary context consideration:

    • Analyze sequence divergence between Surf4 orthologs in different species

    • Identify potentially important amino acid substitutions

    • Design chimeric constructs to map functionally divergent domains

  • Collaborative cross-laboratory validation:

    • Establish collaborations between labs with contradictory results

    • Implement sample and reagent sharing

    • Perform joint experiments with team members from both labs present

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.