Recombinant Talaromyces stipitatus Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Talaromyces stipitatus Altered Inheritance of Mitochondria protein 31, mitochondrial (Aim31), is a protein associated with mitochondrial function in the fungus Talaromyces stipitatus . Originally identified in Saccharomyces cerevisiae (yeast), Aim31 is part of the Hig1 protein family and plays a role in the assembly and function of the cytochrome bc1-c oxidase (COX) supercomplex within mitochondria . In Saccharomyces cerevisiae, deletion of Aim31 alters mitochondrial DNA inheritance, although its function was initially unknown .

Table 1: Key Features of Recombinant Talaromyces stipitatus Aim31

FeatureDescription
Product CodeCSB-EP493533TKZ1
UniProt No.B8MJJ2
SourceE. coli
Immunogen SpeciesTalaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum)
Purity>85% (SDS-PAGE)
Protein LengthPartial
Recommended NameAltered inheritance of mitochondria protein 31, mitochondrial

Role in Respiratory Supercomplex Formation

Rcf1 (Aim31) and Rcf2 (Aim38) are vital for the assembly and stability of the cytochrome bc1-COX supercomplex, which enhances electron transfer and regulation within the electron transport chain . These proteins may influence COX enzyme activity through Cox3 and the associated Cox12 protein, potentially modulated by neighboring ADP/ATP carrier (AAC) proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life is influenced by storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rcf1; aim31; TSTA_046460; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum)
Target Names
rcf1
Target Protein Sequence
MADQADLLESPQFEEETSMQKFKRRLKEEPLIPLGCAATCYALYRAYRSGKAKDSVEMNR MFRARIYAQFFTLLAVVAGGMYYKTERKQRREFERKVEERKAQEKRDAWLRELEAREKED KGWRERHAAVSEAANNPVGVSAVVAGKKEEEEKGVDGNVNQAPQEEGGVKRGTGILDAVK ALVRGKKD
Uniprot No.

Target Background

Function
This protein is a cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Talaromyces stipitatus and its genomic characteristics?

Talaromyces stipitatus is a filamentous fungus belonging to the Ascomycota phylum. The complete genome sequence of T. stipitatus has been determined, enabling comprehensive bioinformatic analysis of its biosynthetic potential . The genome contains genes encoding various polyketide synthases, including highly reducing polyketide synthase (HR-PKS) and nonreducing polyketide synthase (NR-PKS), which are involved in secondary metabolite biosynthesis . T. stipitatus produces polyketides (predominantly tropolones) and polyesters such as talapolyester G, which contains 2,4-dihydroxy-6-(2-hydroxypropyl)benzoate and 3-hydroxybutyrate moieties . Chromosome-scale genome assembly has facilitated gene identification and functional studies within this species .

How does aim31 compare across different fungal species?

Comparative analysis of aim31 across fungal species requires sequence alignment and phylogenetic analysis using approaches similar to those employed for Talaromyces characterization. These typically involve:

  • Genomic DNA extraction from various fungi

  • PCR amplification of the aim31 gene

  • Sequencing of amplified products

  • Multiple sequence alignment and phylogenetic analysis

For Talaromyces species, analysis typically includes examining ITS (Internal Transcribed Spacer), BenA (beta-tubulin), and RPB1 (RNA polymerase II largest subunit) regions for phylogenetic studies . Similar approaches could be applied to aim31 sequences to understand conservation patterns. A comparison between Talaromyces stipitatus aim31 and Neosartorya fumigata aim31 would be particularly valuable given the available information about aim31 in N. fumigata .

What are the optimal protocols for recombinant aim31 expression and purification?

Based on standard protocols for recombinant fungal proteins, the expression and purification process typically follows these steps:

  • Gene Amplification: PCR amplification of aim31 from T. stipitatus genomic DNA

  • Vector Construction: Cloning into an expression vector with appropriate tags

  • Transformation: Introduction into a suitable expression host

  • Expression Optimization: Determination of optimal conditions for protein expression

  • Protein Purification: Multi-step purification process

Purification StepMethodBuffer CompositionExpected Results
Initial CaptureNi-NTA Affinity50 mM Tris pH 8.0, 300 mM NaCl, 20 mM imidazole~60-70% purity
Intermediate PurificationIon Exchange20 mM HEPES pH 7.5, 50-500 mM NaCl gradient~80-85% purity
PolishingSize Exclusion20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM DTT≥85% purity

Challenges often include maintaining proper protein folding and preventing aggregation, particularly for mitochondrial proteins that may have specific structural requirements.

What DNA extraction and PCR protocols are optimal for studying aim31 in Talaromyces stipitatus?

Based on protocols described for similar fungal studies, optimal DNA extraction and PCR amplification would include:

DNA Extraction:

  • Grow T. stipitatus culture for 10-12 days on appropriate media such as Potato Dextrose Agar (PDA) or Malt Extract Agar (MEA)

  • Harvest mycelia and grind in liquid nitrogen

  • Extract genomic DNA using a fungal-specific DNA isolation kit

  • Assess DNA purity using spectrophotometry (e.g., Denovix DS-11)

  • Verify DNA integrity by gel electrophoresis

PCR Amplification:

  • Design primers specific to aim31 gene sequences

  • Prepare PCR reactions using high-fidelity DNA polymerase

  • Follow optimized cycling conditions similar to those used for other Talaromyces genes

  • Purify PCR products using Exo-SAP purification

  • Perform bi-directional sequencing for confirmation

For phylogenetic analysis, researchers often amplify the ITS, BenA, and RPB1 regions, which can be applied to aim31 studies as well .

How can contradictions in aim31 localization studies be resolved experimentally?

Resolving contradictions in protein localization studies requires multiple complementary techniques:

  • Multiple Imaging Approaches:

    • Fluorescent protein tagging at different positions (N- and C-terminal)

    • Immunofluorescence with antibodies against different epitopes

    • High-resolution techniques such as STED or electron microscopy

    • Live-cell imaging to capture dynamic localization patterns

  • Biochemical Fractionation:

    • Rigorous subcellular fractionation to isolate pure mitochondria

    • Western blotting with multiple antibodies

    • Mass spectrometry-based proteomics of isolated organelles

  • Systematic Experimental Design:

    • Testing different growth conditions and developmental stages

    • Using multiple strains to account for strain-specific variations

    • Employing appropriate controls for each experiment

    • Quantitative analysis with statistical validation

When analyzing contradictory results, it's essential to consider that protein localization may be dynamic and condition-dependent, particularly for proteins involved in mitochondrial inheritance, which may relocalize during cell division.

How can bioinformatic analysis identify regulatory elements affecting aim31 expression?

Comprehensive bioinformatic analysis to identify regulatory elements should include:

  • Promoter Analysis:

    • Extract 1-2 kb upstream of the aim31 gene

    • Identify putative transcription factor binding sites using tools like JASPAR

    • Compare with known fungal regulatory motifs

  • Comparative Genomics:

    • Align promoter regions from multiple Talaromyces species

    • Identify conserved non-coding sequences that may represent regulatory elements

    • Use phylogenetic footprinting to detect evolutionarily conserved motifs

  • Functional Analysis:

    • Design reporter constructs with wild-type and mutated promoter regions

    • Integrate bioinformatic predictions with experimental validation

    • Use techniques like CRISPR interference to test functional significance

Similar bioinformatic approaches have been successful in identifying gene clusters and regulatory elements in T. stipitatus for secondary metabolite biosynthesis .

What methodologies are most effective for characterizing aim31 protein-protein interactions?

Comprehensive characterization of protein-protein interactions requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against T. stipitatus aim31 or use epitope tags

    • Prepare mitochondrial extracts under gentle lysis conditions

    • Identify binding partners through mass spectrometry

    • Validate through reciprocal Co-IP experiments

  • Proximity-based Labeling:

    • Create fusion proteins of aim31 with BioID or APEX2

    • Express in T. stipitatus and activate labeling

    • Identify proximal proteins through biotin-based purification and MS

  • In vitro Binding Assays:

    • Express and purify recombinant aim31 (≥85% purity)

    • Perform pull-down assays or surface plasmon resonance

    • Map binding interfaces through mutagenesis

Interaction MethodAdvantagesLimitationsBest Applications
Co-IPDetects native interactionsMay miss weak/transient interactionsStrong, stable complexes
Proximity LabelingCaptures transient interactionsMay label non-interacting proximal proteinsDynamic interaction networks
Yeast Two-HybridHigh-throughput screeningHigh false positive rateInitial interaction discovery
In vitro BindingDirect interaction confirmationMay not reflect in vivo conditionsBinding kinetics and affinity

How can we assess the impact of aim31 mutations on mitochondrial function?

Comprehensive assessment of aim31 mutation effects requires a multi-faceted approach:

  • Generation of Mutant Strains:

    • Create targeted mutations using CRISPR/Cas9 or homologous recombination

    • Design mutations targeting specific functional domains

    • Verify mutations by sequencing

  • Mitochondrial Morphology Analysis:

    • Use fluorescence microscopy to examine mitochondrial network structure

    • Quantify parameters like size, number, and distribution

    • Assess mitochondrial dynamics through time-lapse imaging

  • Functional Assays:

    • Measure oxygen consumption rate using respirometry

    • Assess membrane potential using potential-sensitive dyes

    • Quantify ATP production under different metabolic conditions

    • Measure reactive oxygen species (ROS) production

  • Mitochondrial Inheritance Analysis:

    • Track mitochondrial segregation during cell division

    • Quantify mitochondrial DNA distribution in daughter cells

    • Assess long-term stability of mitochondrial function in progeny

The experimental design should include both deletion mutants and point mutations in specific domains to distinguish essential regions from those that fine-tune function.

What are the challenges in functional studies of recombinant aim31 protein?

Researchers face several challenges when working with recombinant aim31:

  • Maintaining Proper Folding:

    • Mitochondrial proteins often have specific folding requirements

    • Misfolding can occur when expressed in heterologous systems

    • Optimization of expression conditions is critical

  • Post-translational Modifications:

    • Fungal-specific modifications may not occur in bacterial systems

    • Consider eukaryotic expression systems for authentic modifications

  • Solubility and Stability Issues:

    • Mitochondrial membrane proteins can be hydrophobic and prone to aggregation

    • Specialized detergents or fusion tags may be required

    • Storage conditions must be optimized to maintain activity

  • Functional Verification:

    • Developing reliable activity assays for aim31 function

    • Correlating in vitro activity with in vivo function

    • Accounting for potential cofactors or interaction partners

These challenges necessitate careful optimization of experimental conditions and validation through multiple complementary approaches.

How can phylogenetic analysis enhance our understanding of aim31 evolution across fungal species?

Phylogenetic analysis of aim31 can provide valuable evolutionary insights:

  • Conservation of Functional Domains:

    • Identify highly conserved regions likely representing functional domains

    • Map conservation patterns onto structural models

    • Correlate sequence conservation with functional importance

  • Species-specific Adaptations:

    • Detect variations that may reflect adaptations to different ecological niches

    • Identify potential positive selection signatures

    • Correlate sequence variation with mitochondrial inheritance patterns

  • Evolutionary History:

    • Reconstruct the evolutionary history of aim31 across fungi

    • Identify potential gene duplication or horizontal transfer events

    • Compare aim31 evolution with other mitochondrial proteins

Methodologies would follow approaches used for Talaromyces characterization , including DNA extraction, gene amplification, and phylogenetic tree construction using appropriate evolutionary models.

What novel experimental approaches could advance our understanding of aim31 function?

Several cutting-edge approaches could significantly advance aim31 research:

  • Cryo-Electron Microscopy:

    • Determine high-resolution structures of aim31 and its complexes

    • Visualize aim31 in its native mitochondrial environment

    • Map interaction interfaces at atomic resolution

  • Single-Cell Analyses:

    • Track aim31 dynamics in individual cells during division

    • Correlate protein localization with mitochondrial inheritance patterns

    • Measure cell-to-cell variability in aim31 function

  • Synthetic Biology Approaches:

    • Engineer minimal aim31 variants with specific functional domains

    • Create synthetic regulatory circuits to control aim31 expression

    • Design orthogonal systems to study aim31 function in isolation

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop systems biology models of aim31 function

    • Identify emergent properties not apparent from single approaches

These approaches would complement existing methodologies and potentially resolve contradictions in the current understanding of aim31 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.