Recombinant Talaromyces stipitatus Formation of crista junctions protein 1 (fcj1)

Shipped with Ice Packs
In Stock

Description

About Talaromyces stipitatus

Talaromyces stipitatus is a non-pathogenic filamentous fungus commonly found in soil, dung, and decaying plant material . It is closely related to Penicillium marneffei, a pathogenic fungus known to cause infections in humans with AIDS . Formerly known as Penicillium stipitatum, Talaromyces stipitatus has been reclassified into the Talaromyces genus .

Talaromyces stipitatus has several notable characteristics:

  • Habitat: Saprophytic, residing in soil, dung and decaying plant matter .

  • Enzymes: It produces feruloyl esterases that can hydrolyze ester bonds between hydroxycinnamic acids and sugars found in plant cell walls, making it useful in agri-food industries .

  • Genetic Information: Genomic data for Talaromyces stipitatus is available from the J. Craig Venter Institute .

While generally non-pathogenic, Talaromyces stipitatus has been identified as a causal agent of superficial mycosis in a 65-year-old diabetic male . This identification marks a new addition to the list of non-dermatophytes associated with human skin infections .

Crista Junctions and Fcj1

Crista junctions are structures found within the mitochondria of eukaryotic cells. Mitochondria are essential organelles responsible for energy production through oxidative phosphorylation. Cristae are the infoldings of the inner mitochondrial membrane, which increases the surface area available for these processes. Crista junctions are critical in maintaining the structure and function of cristae, influencing energy output and cell metabolism.

Fcj1, or Formation of Crista Junctions 1, is a protein involved in the formation and maintenance of these crista junctions . Although primarily studied in other organisms, the presence and function of Fcj1 in Talaromyces stipitatus could have implications for the fungus's metabolism and response to environmental stressors.

Secondary metabolites from Talaromyces

Talaromyces species produce diverse secondary metabolites, including esters, terpenes, steroids, alkaloids, and polyketides, which exhibit antibacterial, anti-inflammatory, antitumor, and antioxidant properties . For example, Talaromyces flavus produces talapolyesters with cytotoxic activity against tumor cells, while compounds from Talaromyces pinophilus show inhibitory activity against Clostridium perfringens and Bacillus subtilis .

Potential research directions

Given the information, research on Recombinant Talaromyces stipitatus Formation of crista junctions protein 1 (fcj1) could explore:

  • The specific structure and function of Fcj1 in Talaromyces stipitatus.

  • The role of Fcj1 in the fungus's response to stress.

  • The impact of Fcj1 on the production of secondary metabolites.

  • The potential biotechnological applications of modifying Fcj1 in Talaromyces stipitatus for industrial or pharmaceutical purposes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MIC60; TSTA_046570; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-639
Protein Length
Full Length of Mature Protein
Species
Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum)
Target Names
MIC60
Target Protein Sequence
ADPKNVQPTSPTPVSPESKSVIPPETVNSVTTTPTTQVQTSPPSSIQPPQPPVENPSTGS VPPPPPKRKGRFRRFLLYLILTSGIAYGGGVFAALKSDNFHDFFTEYVPYGEEAVLYFEE RDFYRRFPNATRHSNRLPPIHKEESQRVTIPSKSGLSWKVAEEESDSGSLTQKGPHNSAV SASKDTTGAKAVTKAKEERAEKKAPAKKEAPAPAPQEETRTPAITPPTTLELVKVEHADE PVVQEVVRIFNDIITVISADEGAASKYAAPISRVRTELESIGEKIVSLRAEAQKAAKEEI EKAHALFDESAKKLMQQIETARAAEAAQFREEFEAEREKLSRAYQDKIQTELARAQELAE QRLKNELVEQAIELNRKYLNDVKELVERERDGRLSKISELTANVNQLEKLTTDWSDVIET NLKTQQLQVAVDAVRSVLENAASAKPFVRELVAVKELAADDPVVAAAIASINPTAYQRGI PTTSQIIDRFRRVAGEVRKASLLPEDAGIASHAASFVLSKVMFKRDAVTDGNDVESVLVR TENLLEEGNLDAAAREMNTLQGWAKILSKDWLADVRRVLEVKQALEVMETEARLQCLRVE S
Uniprot No.

Target Background

Function

Recombinant Talaromyces stipitatus Formation of Crista Junctions Protein 1 (fcj1): A component of the Mitochondrial Contact Site and Cristae Organizing System (MICOS) complex, a large protein assembly within the inner mitochondrial membrane. MICOS plays critical roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating contact site formation with the outer membrane. Fcj1 specifically contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane and supports protein import through the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Fcj1 and what is its fundamental role in mitochondrial architecture?

Fcj1 (Formation of crista junctions protein 1), also known as MIC60, is a mitochondrial inner membrane protein that plays a crucial role in the formation of crista junctions (CJs). These are tubular invaginations that connect the inner boundary membrane with the cristae membrane in mitochondria. Fcj1 is specifically enriched at CJs and is essential for their formation and maintenance .

Functionally, Fcj1 acts as an antagonist to the F1FO-ATP synthase subunits e and g, which promote the oligomerization of F1FO-ATP synthase at cristae tips. This antagonistic relationship helps maintain the proper balance of membrane curvature required for normal mitochondrial morphology .

What happens to mitochondrial structure when Fcj1 is absent or modified?

The absence of Fcj1 leads to severe mitochondrial abnormalities:

  • Loss of crista junctions

  • Formation of concentric stacks of inner membrane within the mitochondrial matrix

  • Increased levels of F1FO-ATP synthase supercomplexes

  • Aggregation of mtDNA nucleoids, which increase in size and decrease in number

Conversely, overexpression of Fcj1 causes:

  • Increased CJ formation

  • Branching of cristae

  • Enlargement of CJ diameter

  • Reduced levels of F1FO supercomplexes

These observations demonstrate that Fcj1 is essential for maintaining normal mitochondrial morphology and the proper distribution of protein complexes within mitochondrial membranes.

What is known about Talaromyces stipitatus as a source organism?

Talaromyces stipitatus is a filamentous fungus belonging to the phylum Ascomycota. It is part of the genus Talaromyces, which includes several species known for their production of bioactive secondary metabolites .

T. stipitatus is known to produce:

  • Polyketides, predominantly tropolones

  • Phenalenone dimers with antimicrobial properties

  • Polyesters including talapolyester G and other 15G256 series compounds

  • Macrolide polyesters such as talaromacrolactone A

Recently, T. stipitatus has been identified as a potential human pathogen, with a case report documenting it as the causative agent of superficial mycosis in a diabetic patient in India .

What is the significance of the C-terminal domain of Fcj1 for crista junction formation?

The C-terminal domain of Fcj1 is the most conserved part of the protein and is essential for its function in crista junction formation. Detailed structural and functional studies have revealed:

  • The C-terminal domain is critical for the interaction of Fcj1 with the TOB/SAM complex (Translocase of Outer membrane β-barrel proteins/Sorting and Assembly Machinery) .

  • This domain interacts with full-length Fcj1, suggesting a role in oligomer formation .

  • In the absence of the C-terminal domain:

    • Formation of CJs is strongly impaired and irregular

    • Stacked cristae are present

    • The genetic interaction with F1FO-ATP synthase subunit e is lost

  • The Fcj1-TOB/SAM interaction stabilizes CJs in close proximity to the outer membrane, explaining how CJs are positioned at sites where cristae meet the inner boundary membrane .

This suggests a model where the C-terminal domain anchors Fcj1 to the outer membrane via TOB/SAM, creating a physical link between inner and outer mitochondrial membranes that defines the position of crista junctions.

What methods are used to express and characterize recombinant T. stipitatus Fcj1?

Expression and characterization of recombinant T. stipitatus Fcj1 involve several methodological approaches:

Expression Systems:

  • E. coli has been successfully used for the expression of recombinant full-length T. stipitatus Fcj1 (amino acids 39-639) with an N-terminal His tag .

  • Similar fungal proteins from T. stipitatus, such as feruloyl esterase (FAEC), have been expressed in Pichia pastoris with various signal peptides for secretion .

Purification Approaches:

  • Affinity chromatography using the His tag

  • Lyophilization for storage

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

Characterization Methods:

  • SDS-PAGE for purity assessment (>90%)

  • Western blotting for detection

  • Functional assays to assess protein activity

  • Subcellular localization studies using fluorescence microscopy

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

How do Fcj1 and the TOB/SAM complex interact to maintain mitochondrial architecture?

The interaction between Fcj1 and the TOB/SAM complex represents a crucial link between mitochondrial inner and outer membranes that influences cristae morphology:

  • Physical Interaction: The C-terminal domain of Fcj1 interacts directly with Tob55, a component of the TOB/SAM complex .

  • Localization Dependency: The association of the TOB/SAM complex with contact sites between inner and outer membranes depends on the presence of Fcj1 .

  • Functional Impact:

    • Down-regulation of the TOB/SAM complex leads to altered cristae morphology

    • There is a moderate reduction in the number of CJs when TOB/SAM is compromised

    • The biogenesis of β-barrel proteins is not significantly affected in the absence of Fcj1

  • Proposed Mechanism: The C-terminal domain of Fcj1 anchors to the TOB/SAM complex in the outer membrane, thereby stabilizing CJs in close proximity to the outer membrane. This explains the spatial organization of CJs at sites where cristae meet the inner boundary membrane .

This interaction provides insight into how the complex architecture of mitochondrial membranes is established and maintained, revealing a novel function for the TOB/SAM complex beyond its established role in protein import.

What experimental approaches can be used to study the effects of Fcj1 deletion or modification on mitochondrial function?

Several experimental approaches have been employed to study the effects of Fcj1 deletion or modification:

Genetic Approaches:

  • Gene deletion (knockout) studies in model organisms like yeast

  • Construction of truncated variants lacking specific domains (e.g., C-terminal domain)

  • Site-directed mutagenesis of critical residues

  • Overexpression studies to observe gain-of-function effects

Morphological Analysis:

  • Electron microscopy to visualize mitochondrial ultrastructure

  • Immuno-electron microscopy to locate specific proteins

  • Fluorescence microscopy with mitochondrial markers

  • Super-resolution microscopy for detailed structural analysis

Functional Assays:

  • Assessment of F1FO-ATP synthase oligomerization state

  • Measurement of mitochondrial membrane potential

  • Analysis of mitochondrial DNA (mtDNA) nucleoid distribution and size

  • Respiratory chain activity measurements

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation to identify interaction partners

  • Yeast two-hybrid assays

  • FRET/BRET analysis for in vivo interaction studies

  • Crosslinking approaches followed by mass spectrometry

A comprehensive study typically involves combining these approaches to correlate structural changes with functional outcomes.

How does Fcj1 influence mtDNA nucleoid distribution and what are the implications for mitochondrial genetics?

Fcj1 plays an unexpected role in maintaining the distribution and size of mtDNA nucleoids, which has significant implications for mitochondrial genetics:

  • Observed Effects in Fcj1-Deficient Cells:

    • Nucleoids aggregate

    • Nucleoids increase in size

    • Nucleoids decrease in number

    • Fcj1 forms punctate structures localized adjacent to nucleoids

  • Relationship with Mitochondrial Division:

    • Connecting mitochondria by deleting the DNM1 gene (required for organelle division) enhances aggregation of mtDNA nucleoids in fcj1 cells

    • Single deletion of DNM1 does not affect nucleoids

    • This suggests that mitochondrial division and Fcj1 function cooperatively in nucleoid distribution

  • Interaction with F1FO-ATP Synthase:

    • Deleting F1FO-ATP synthase dimerization factors generates concentric ring-like cristae

    • This restores tubular mitochondrial morphology

    • It also suppresses nucleoid aggregation in fcj1 mutants

  • Implications:

    • Proper nucleoid distribution is essential for mitochondrial inheritance during cell division

    • Aggregated nucleoids may impair the segregation of mtDNA during mitochondrial division

    • This could lead to mitochondrial genetic defects and potentially contribute to mitochondrial diseases

These findings establish a link between mitochondrial membrane architecture and the organization of the mitochondrial genome, highlighting the multifaceted role of Fcj1 in mitochondrial biology.

What comparative analyses can be performed between T. stipitatus Fcj1 and homologs from other species?

Comparative analyses of Fcj1/MIC60 proteins across different species provide valuable insights into evolutionary conservation and functional specialization:

Sequence Analysis Approaches:

  • Multiple sequence alignment to identify conserved domains and motifs

  • Phylogenetic analysis to establish evolutionary relationships

  • Conservation mapping onto structural models

  • Identification of species-specific insertions or deletions

Structural Comparisons:

  • Secondary structure prediction

  • 3D homology modeling based on available structures

  • Analysis of predicted protein-protein interaction interfaces

  • Computational simulation of protein dynamics

Functional Complementation Studies:

  • Expression of T. stipitatus Fcj1 in other species with fcj1 deletion

  • Assessment of cross-species functional conservation

  • Domain swapping experiments to identify species-specific functional regions

  • Evolution of mitochondrial membrane architecture across different fungal lineages

Comparison Table of Fcj1/MIC60 Features Across Species:

SpeciesProtein NameSize (aa)Key DomainsNotable FeaturesReference
Talaromyces stipitatusFcj1/MIC60639C-terminal domainInvolved in crista junction formation
Saccharomyces cerevisiaeFcj1~550Coiled-coil, C-terminalAntagonizes F1FO-ATP synthase subunits e and g
MammalsMitofilin/IMMT~750Coiled-coil, C-terminalPart of MICOS/MINOS/MitOS complex

Such comparisons can reveal the core conserved functions of Fcj1 while also highlighting adaptations that may relate to species-specific mitochondrial morphology or energy metabolism requirements.

What are the optimal conditions for expressing and purifying recombinant T. stipitatus Fcj1?

Based on available data for recombinant T. stipitatus Fcj1 and related proteins, the following conditions are recommended:

Expression System Selection:

  • E. coli has been successfully used for full-length T. stipitatus Fcj1 (aa 39-639) with an N-terminal His tag

  • For glycosylated proteins or those requiring eukaryotic post-translational modifications, Pichia pastoris may be preferable, as demonstrated with other T. stipitatus proteins

Expression Optimization:

  • Temperature: Often lowered to 16-25°C after induction to improve folding

  • Induction time: Typically 4-16 hours depending on protein stability

  • Media composition: Addition of solubility enhancers like sorbitol or betaine may help

  • Co-expression with chaperones can improve yield of properly folded protein

Purification Protocol:

  • Cell lysis: Sonication or high-pressure homogenization in buffer containing:

    • 20-50 mM Tris-HCl, pH 8.0

    • 150-300 mM NaCl

    • 5-10% glycerol

    • Protease inhibitors

  • Affinity purification: Ni-NTA chromatography for His-tagged protein

  • Optional secondary purification: Size exclusion chromatography

  • Final preparation: Buffer exchange to remove imidazole, followed by concentration

  • Storage: Lyophilization or storage in buffer with 6% trehalose at -80°C

Quality Control:

  • SDS-PAGE to confirm >90% purity

  • Western blotting to verify identity

  • Functional assays to confirm activity

  • Mass spectrometry to verify integrity

How can researchers effectively design experiments to study Fcj1-mediated protein-protein interactions?

Studying Fcj1-mediated protein-protein interactions requires a multi-faceted approach:

In Vitro Approaches:

  • Pull-down Assays:

    • Immobilize purified recombinant His-tagged Fcj1 on Ni-NTA resin

    • Incubate with potential interaction partners (e.g., TOB/SAM complex components)

    • Wash and elute bound proteins for analysis by Western blot or mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize Fcj1 on a sensor chip

    • Flow potential binding partners over the surface

    • Measure binding kinetics and affinity constants

  • Isothermal Titration Calorimetry (ITC):

    • Provides thermodynamic parameters of interactions

    • No labeling required

    • Works with purified components

In Vivo Approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged Fcj1 in cells

    • Lyse cells and precipitate Fcj1 with appropriate antibodies

    • Identify co-precipitated proteins by Western blot or mass spectrometry

  • Proximity-based Labeling:

    • Fuse Fcj1 to BioID or APEX2

    • These enzymes biotinylate proteins in close proximity

    • Identify biotinylated proteins by streptavidin pull-down followed by mass spectrometry

  • Two-hybrid Systems:

    • Use yeast or bacterial two-hybrid systems to screen for interactions

    • Split-ubiquitin systems are particularly suitable for membrane proteins like Fcj1

Visualization Approaches:

  • FRET/BRET Analysis:

    • Fuse Fcj1 and potential partners to fluorescent/luminescent proteins

    • Measure energy transfer as indicator of proximity (<10 nm)

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments are fused to potential interaction partners

    • Fluorescence occurs only when proteins interact, bringing fragments together

These methods have successfully identified interactions between Fcj1 and the TOB/SAM complex, as well as interactions with the full-length Fcj1 itself, suggesting a role in oligomer formation .

What imaging techniques are most appropriate for visualizing Fcj1 localization in mitochondria?

Visualizing Fcj1 localization in mitochondria requires specialized imaging techniques due to the small size of mitochondria and the specific localization of Fcj1 at crista junctions:

Conventional Fluorescence Microscopy:

  • Immunofluorescence:

    • Fixed cells labeled with antibodies against Fcj1

    • Co-staining with mitochondrial markers (e.g., MitoTracker)

    • Limited by diffraction to ~200 nm resolution

  • Fluorescent Protein Tagging:

    • Expression of Fcj1 fused to GFP or other fluorescent proteins

    • Allows live-cell imaging

    • Can affect protein function; careful validation needed

Super-resolution Microscopy:

  • Stimulated Emission Depletion (STED) Microscopy:

    • Achieves resolution of ~30-80 nm

    • Can resolve individual crista junctions

    • Requires specialized fluorophores

  • Single-Molecule Localization Microscopy (PALM/STORM):

    • Resolution down to ~20 nm

    • Allows quantitative analysis of protein distribution

    • Requires photoactivatable/photoswitchable fluorophores

  • Structured Illumination Microscopy (SIM):

    • ~100 nm resolution

    • Compatible with standard fluorophores

    • Good for live-cell imaging of dynamics

Electron Microscopy Approaches:

  • Immuno-electron Microscopy:

    • Gold-labeled antibodies against Fcj1

    • Provides ultrastructural context

    • Definitive for localization at crista junctions

    • Used in landmark studies of Fcj1

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines fluorescence and electron microscopy

    • Links molecular specificity with ultrastructural detail

    • Challenging but highly informative

  • Electron Tomography:

    • 3D reconstruction of mitochondrial membranes

    • Reveals spatial relationship between Fcj1 and membrane architecture

Research has shown that Fcj1 is specifically enriched at crista junctions and is not accumulated in cristae tips where F1FO-ATP synthase is enriched , highlighting the importance of high-resolution imaging for accurate localization.

How can recombinant T. stipitatus Fcj1 be used as a tool to study mitochondrial architecture?

Recombinant T. stipitatus Fcj1 can serve as a valuable tool for studying mitochondrial architecture in several ways:

Structural Studies:

  • Use purified protein for crystallography or cryo-EM structure determination

  • Generate domain-specific antibodies for functional studies

  • Perform in vitro reconstitution with lipid membranes to study membrane shaping properties

Functional Reconstitution:

  • Express in fcj1-deficient cells from different species to assess complementation

  • Create chimeric proteins with domains from different species to map functional regions

  • Perform structure-function analysis through site-directed mutagenesis

Interaction Studies:

  • Use as bait in pull-down experiments to identify novel interaction partners

  • Characterize binding affinities with known partners like TOB/SAM complex components

  • Map interaction domains through truncation analysis

Biotechnological Applications:

  • Develop Fcj1-based tools for manipulating mitochondrial architecture

  • Create biosensors for mitochondrial membrane organization

  • Use as a target for screening compounds that modulate mitochondrial structure

The unique properties of T. stipitatus Fcj1, possibly adapted to the specific environmental conditions this fungus encounters, may provide new insights into the fundamental principles governing mitochondrial architecture.

What are the potential implications of Fcj1 research for understanding mitochondrial diseases?

Research on Fcj1 has significant implications for understanding mitochondrial diseases:

Pathophysiological Relevance:

  • Mitochondrial architecture abnormalities are observed in various diseases, including neurodegenerative disorders

  • Alterations in cristae structure affect oxidative phosphorylation efficiency

  • mtDNA nucleoid aggregation, observed in fcj1-deficient cells , may impair mitochondrial genetic integrity

Disease Mechanisms:

  • Disruption of crista junction formation may contribute to:

    • Reduced respiratory chain efficiency

    • Altered apoptotic signaling (cytochrome c release)

    • Impaired mitochondrial calcium handling

    • Oxidative stress due to electron leakage

  • Abnormal mtDNA nucleoid distribution could lead to:

    • Heteroplasmy shifts

    • mtDNA depletion in some mitochondria

    • Impaired mitochondrial division and inheritance

Therapeutic Implications:

  • Fcj1/MIC60 could serve as a target for therapies aimed at modulating mitochondrial architecture

  • Understanding Fcj1 function might inform approaches to rescue mitochondrial structural defects

  • The interaction between Fcj1 and F1FO-ATP synthase suggests potential for metabolic modulation

Diagnostic Applications:

  • Structural analysis of mitochondria in patient samples could reveal specific defects in Fcj1-related pathways

  • Genetic screening for mutations in Fcj1/MIC60 and interacting partners

  • Development of biomarkers related to mitochondrial structural integrity

The discovery that both Fcj1 and mitochondrial division are required for proper nucleoid distribution provides a mechanistic link between mitochondrial dynamics, architecture, and genetics that may be central to understanding mitochondrial dysfunction in disease.

How might the study of fungal Fcj1 proteins inform our understanding of mitochondrial evolution?

Studying fungal Fcj1 proteins offers valuable insights into mitochondrial evolution:

Evolutionary Conservation:

  • The C-terminal domain of Fcj1 is highly conserved across species , suggesting fundamental importance in mitochondrial function

  • Comparison of Fcj1 across different fungal lineages can reveal evolutionary adaptations to different ecological niches

  • Talaromyces stipitatus, as a soil fungus with unique secondary metabolites , may have evolved specific adaptations in mitochondrial architecture

Functional Divergence:

  • Differences in Fcj1 structure between fungi and higher eukaryotes may reflect:

    • Adaptations to different metabolic requirements

    • Responses to environmental stressors

    • Co-evolution with interacting proteins

  • Comparative analysis of Fcj1-protein interactions across species can reveal:

    • Core conserved complexes essential for basic mitochondrial architecture

    • Lineage-specific interactors that confer specialized functions

Evolutionary Origins of Mitochondrial Architecture:

  • Fungi represent good model systems to study the evolution of complex mitochondrial membrane structures

  • The interaction between Fcj1 and the TOB/SAM complex suggests an evolutionary link between protein import machinery and membrane architecture

  • The antagonistic relationship between Fcj1 and F1FO-ATP synthase may represent an ancient regulatory mechanism for balancing energy production and membrane organization

Implications for Endosymbiont Theory:

  • Understanding how mitochondrial membrane architecture evolved provides insights into the adaptation of the ancestral endosymbiont

  • The evolution of crista junctions may represent a key innovation in mitochondrial function

  • Comparison with bacterial membrane organization can reveal evolutionary innovations specific to mitochondria

Comprehensive phylogenetic analysis of Fcj1 across fungal species, including the recently sequenced mitochondrial genome of Talaromyces sp. strain PC 2 MIBA 0026 , could provide a framework for understanding how mitochondrial architecture has evolved in response to different ecological and metabolic demands.

How can knowledge about T. stipitatus Fcj1 contribute to biotechnological applications?

Knowledge about T. stipitatus Fcj1 has several potential biotechnological applications:

Protein Engineering:

  • Development of Fcj1 variants with enhanced stability or specific properties

  • Creation of chimeric proteins combining domains from different species for novel functions

  • Engineering Fcj1-based tools for manipulating mitochondrial architecture in heterologous systems

Bioprocess Applications:

  • Optimization of T. stipitatus cultivation for enhanced production of valuable metabolites

  • Manipulation of mitochondrial architecture to improve cellular energy efficiency in industrial strains

  • Engineering stress resistance through modulation of mitochondrial membrane organization

Pharmaceutical Potential:

  • Development of small molecule modulators of Fcj1 function for research tools

  • Targeting the Fcj1-TOB/SAM interaction as a novel approach for antifungal development

  • Exploration of T. stipitatus secondary metabolites that may interact with mitochondrial pathways

Biomedical Applications:

  • Using recombinant Fcj1 as a research tool for studying mitochondrial diseases

  • Development of biosensors for mitochondrial membrane organization

  • Creation of model systems for testing compounds that restore normal mitochondrial architecture in disease states

Agricultural Applications:

  • Engineering fungal strains with modified Fcj1 for improved stress resistance

  • Development of antifungal strategies targeting Fcj1 in pathogenic fungi

  • Exploitation of T. stipitatus enzymes, such as feruloyl esterase , for biomass processing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.