Recombinant Talpa europaea Aquaporin-2 (AQP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is preferred, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Talpa europaea (European mole)
Target Names
AQP2
Target Protein Sequence
SIAFSRAVFAEFLATLIFVFFGLGSALNWQQSLPSVLQIAMAFGLAIGTLVQALGHISGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEVTPSDVRG
Uniprot No.

Target Background

Function
Aquaporin-2 (AQP2) forms a water-specific channel that provides the plasma membranes of renal collecting duct cells with high permeability to water. This enables water movement along osmotic gradients.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Talpa europaea AQP2 and how does it compare to human AQP2?

Talpa europaea (European mole) AQP2 is a water channel protein consisting of 109 amino acids that functions in water transport across cell membranes. While sharing functional similarities with human AQP2 as a vasopressin-regulated water channel, the Talpa europaea variant has species-specific structural differences. The recombinant form is typically expressed with an N-terminal His tag in E. coli expression systems . Human AQP2, in comparison, plays a critical role in urine concentration in the kidney collecting ducts, and its dysfunction leads to nephrogenic diabetes insipidus (NDI) . Researchers should note these differences when designing cross-species comparative studies.

What are the optimal storage conditions for recombinant Talpa europaea AQP2?

Optimal storage of recombinant Talpa europaea AQP2 requires careful handling to maintain protein integrity. Store the lyophilized powder at -20°C/-80°C upon receipt. After reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add glycerol to a final concentration of 5-50% (optimally 50%) and aliquot for long-term storage at -20°C/-80°C. Avoid repeated freeze-thaw cycles as they significantly reduce protein activity. For short-term use, working aliquots can be stored at 4°C for up to one week . Researchers should verify protein stability using SDS-PAGE before experimental use.

How can I establish a cell system to study AQP2 trafficking and function?

To establish a robust cell system for studying AQP2 trafficking and function, consider implementing a Flp-In T-REx system similar to that used with Madin-Darby canine kidney (MDCK) cells, which allows temporal and quantitative control of AQP2 expression. This approach enables:

  • Inducible expression with tetracycline or doxycycline

  • Stable integration at a specific genomic locus

  • Co-expression with fluorescently tagged variants for time-lapse imaging

  • Analysis of phosphorylation-dependent trafficking

This system has been validated for studying cAMP-dependent translocation of AQP2 to the plasma membrane and for investigating AQP2-containing tubulating endosomes. For phosphorylation studies, incorporate phospho-mimicking mutants like S256A (preventing phosphorylation) and S256D (mimicking phosphorylation) . Quantify membrane localization using surface biotinylation or confocal microscopy with membrane markers.

How does the structure of AQP2 relate to its water transport function?

The structure-function relationship of AQP2 is fundamental to understanding its water transport mechanism. AQP2, like other aquaporins, forms a homotetramer with each monomer containing six transmembrane domains and two half-helices that form a narrow aqueous pore. Key structural features include:

  • NPA (Asparagine-Proline-Alanine) motifs that form the water selectivity filter

  • Ar/R (aromatic/arginine) constriction site that determines pore selectivity

  • Phosphorylation sites (particularly S256) that regulate membrane trafficking

These structural elements enable highly efficient water permeation while excluding ions and protons ("proton exclusion mechanism"). Further structural analysis of Talpa europaea AQP2 is needed to fully understand potential gating mechanisms that may regulate channel function . Functional studies comparing wild-type and mutant AQP2 variants can provide insights into structure-function relationships.

What role does phosphorylation play in AQP2 regulation?

Phosphorylation is a critical post-translational modification that regulates AQP2 function and trafficking. Multiple phosphorylation sites have been identified, with S256 being particularly important. The effects include:

  • S256 phosphorylation (triggered by vasopressin/cAMP signaling) promotes AQP2 trafficking to the plasma membrane

  • Dephosphorylation leads to endocytosis and intracellular retention

Experimental evidence demonstrates that phospho-mimicking mutants (S256D) predominantly localize to the plasma membrane, while phospho-deficient mutants (S256A) remain primarily intracellular . Interestingly, endosomal tubulation differs between these mutants, with S256A-containing endosomes exhibiting tubulation while S256D-containing endosomes do not, suggesting phosphorylation regulates not only membrane insertion but also endosomal trafficking dynamics . For studying these processes, researchers can use phospho-specific antibodies, phospho-mimicking mutants, and pharmacological manipulation of kinases and phosphatases.

How can I design meaningful comparative studies between Talpa europaea AQP2 and AQP2 from other species?

Designing meaningful comparative studies requires careful consideration of evolutionary conservation and divergence. Follow these methodological steps:

  • Perform multiple sequence alignment of AQP2 sequences from various species to identify conserved and variable regions

  • Generate a phylogenetic tree to establish evolutionary relationships

  • Focus on functionally important domains (NPA motifs, selectivity filters, phosphorylation sites)

  • Combine structural bioinformatics with experimental approaches like site-directed mutagenesis

When comparing Talpa europaea AQP2 with human, rat, or other mammalian AQP2s, consider creating chimeric proteins or reciprocal mutations to identify species-specific functional determinants. Functional assays should include water permeability measurements (e.g., using Xenopus oocytes or cell swelling assays) and trafficking studies in response to relevant stimuli .

What insights can be gained from studying AQP2 in different species such as Talpa europaea versus other mammals?

Studying AQP2 across diverse species like Talpa europaea (European mole) versus humans, rats, or other mammals provides valuable insights into functional adaptation and evolutionary conservation. Key comparative aspects include:

  • Adaptations to different habitats and physiological demands (e.g., aquatic vs. terrestrial, arid vs. humid environments)

  • Conservation of regulatory mechanisms (e.g., vasopressin responsiveness)

  • Variant-specific structural features that may confer unique properties

For instance, while the basic function of AQP2 in regulating water balance is conserved, species-specific differences may exist in trafficking kinetics, regulatory pathways, or osmoregulatory capacity. Understanding these differences can illuminate the adaptive significance of AQP2 variants and potentially identify novel regulatory mechanisms . Researchers should design comparative experiments with carefully matched controls and standardized conditions to enable meaningful cross-species comparisons.

What are the challenges in expressing and purifying functional recombinant AQP2 for structural studies?

Expressing and purifying functional recombinant AQP2 for structural studies presents several challenges that researchers must address:

  • Membrane protein solubilization: AQP2 is a membrane protein requiring detergents for extraction and purification, but detergent selection is critical as inappropriate detergents can destabilize the protein.

  • Expression systems optimization: While E. coli is commonly used , expressing mammalian membrane proteins can lead to inclusion body formation. Consider:

    • Testing multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Optimizing induction conditions (temperature, IPTG concentration, duration)

    • Alternative expression systems (insect cells, yeast)

  • Protein stability: AQP2 may denature during purification. Implement stability assessments using:

    • Thermal shift assays

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Limited proteolysis

  • Functional validation: Verify that purified AQP2 retains water channel activity using:

    • Reconstitution into proteoliposomes for water permeability assays

    • Structural integrity assessment via circular dichroism

For high-resolution structural studies (X-ray crystallography or cryo-EM), focus on protein homogeneity, removing flexible regions that may hinder crystallization, and screening multiple crystallization conditions.

How can advanced imaging techniques be applied to study AQP2 trafficking and dynamics?

Advanced imaging techniques offer powerful approaches for studying AQP2 trafficking and dynamics at high spatial and temporal resolution. Methodology recommendations include:

  • Live-cell imaging with fluorescently tagged AQP2:

    • Use the Flp-In T-REx system for controlled expression of fluorescently tagged AQP2

    • Combine with transient, low expression of EGFP-tagged AQP2 to avoid aggregation

    • Perform time-lapse imaging to capture dynamic events such as tubulating endosomes

  • Super-resolution microscopy:

    • PALM/STORM techniques for nanoscale localization

    • STED microscopy for visualizing AQP2 clustering

    • SIM for improved resolution of endosomal structures

  • Multi-color imaging:

    • Co-localization with endosomal markers (Rab proteins)

    • Membrane insertion dynamics with plasma membrane markers

    • Correlation with phosphorylation status using phospho-specific antibodies

  • Advanced analysis methods:

    • Particle tracking for measuring vesicle motility

    • Fluorescence correlation spectroscopy for diffusion dynamics

    • FRET-based approaches for protein-protein interactions

Research has shown that tubulation of AQP2-containing endosomes significantly decreases 30 minutes after cAMP elevation, and that this process differs between phospho-mimicking mutants (S256A vs S256D) . These dynamics provide important insights into the mechanisms of AQP2 regulation.

How does AQP2 function in water balance regulation and what are the implications for research?

AQP2 plays a pivotal role in water balance regulation through a vasopressin-dependent mechanism. In the kidney collecting duct, AQP2 facilitates water reabsorption when inserted into the apical membrane in response to vasopressin, which acts through cAMP signaling to trigger AQP2 translocation from intracellular vesicles . This process is essential for urine concentration.

Research implications include:

  • Mechanistic studies: Investigating the detailed molecular mechanisms of AQP2 trafficking provides insights into fundamental cellular processes.

  • Therapeutic targets: Understanding AQP2 regulation can identify novel targets for treating water balance disorders.

  • Comparative physiology: Studying AQP2 across species (including Talpa europaea) illuminates evolutionary adaptations in water conservation strategies.

  • Environmental adaptation: Exploring how AQP2 function responds to environmental challenges (like in the fish models in salinity studies) reveals physiological plasticity mechanisms .

Researchers should design experiments that capture the dynamic regulation of AQP2 under physiologically relevant conditions, considering factors such as osmotic gradients, hormonal regulation, and cellular energy status.

What can we learn from AQP2 mutations and their relationship to nephrogenic diabetes insipidus?

The study of AQP2 mutations and their relationship to nephrogenic diabetes insipidus (NDI) provides a powerful model for understanding structure-function relationships and protein quality control mechanisms. NDI caused by AQP2 mutations is characterized by impaired urine concentration despite normal or elevated vasopressin levels .

Key methodological considerations for research in this area include:

  • Genotype-phenotype correlations:

    • Classify mutations based on location (transmembrane domains, loops, termini)

    • Correlate with clinical severity (complete vs. partial NDI)

    • Analyze effects on protein folding, trafficking, and function

  • Experimental approaches:

    • Express mutant proteins in cellular models to assess trafficking and function

    • Use fluorescently tagged constructs to visualize subcellular localization

    • Perform water permeability assays to quantify functional impacts

  • Rescue strategies investigation:

    • Chemical chaperones for misfolded mutants

    • Trafficking enhancers for retention-defective mutants

    • Bypassing strategies for signaling-defective mutants

This research not only enhances our understanding of AQP2 biology but also provides insights into potential therapeutic approaches for NDI and other water balance disorders . Comparing the effects of equivalent mutations in AQP2 from different species, including Talpa europaea, could reveal species-specific differences in protein quality control and compensatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.