Recombinant Tamandua tetradactyla NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Tamandua tetradactyla MT-ND4L

Recombinant Tamandua tetradactyla NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a mitochondrial protein engineered for research applications. This protein is a subunit of Complex I (NADH dehydrogenase), a critical enzyme in the mitochondrial electron transport chain responsible for ATP synthesis . Derived from the Southern anteater (Tamandua tetradactyla), this recombinant variant enables comparative studies of mitochondrial function across species and investigation of metabolic disorders linked to Complex I dysfunction .

Functional Role in Mitochondrial Complex I

MT-ND4L is integral to Complex I’s proton-pumping machinery:

  • Electron Transfer: Facilitates NADH oxidation, transferring electrons to ubiquinone via FMN and iron-sulfur clusters .

  • Proton Translocation: Drives the movement of 4 H+ ions across the mitochondrial inner membrane, contributing to ATP synthesis .

  • Structural Stability: Forms part of the transmembrane core with other hydrophobic subunits (ND1, ND2, ND3, ND4, ND5, ND6) .

In Tamandua tetradactyla, this subunit’s recombinant form allows for cross-species analysis of evolutionary adaptations in mitochondrial energetics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your demand.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Tamandua tetradactyla (Southern anteater) (Myrmecophaga tetradactyla)
Target Names
Target Protein Sequence
MSSIYMNILLAFTMALLGLLMYRSHLMSSLLCLEGMMLSLFILSTVTMLNTSFTLSSMMP VMLMVFAACEAAVGLALLVTVSNTYGLDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its primary function in mitochondrial metabolism?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a crucial component of Complex I in the mitochondrial electron transport chain. This protein participates in oxidative phosphorylation, specifically in the first step of electron transport process. MT-ND4L functions in the transfer of electrons from NADH to ubiquinone, creating an electrochemical gradient across the inner mitochondrial membrane that drives ATP production . The protein is embedded in the inner mitochondrial membrane and works in concert with other complex I components to facilitate energy production. Alternative names include NADH dehydrogenase subunit 4L, with gene synonyms MTND4L, NADH4L, and ND4L .

What are the nucleotide composition characteristics of Tamandua tetradactyla MT-ND4L?

The nucleotide composition of Tamandua tetradactyla MT-ND4L shows the following characteristics:

SpeciesGC (%)AT (%)G (bases)C (bases)A (bases)T (bases)Maximum lifespan (yrs)
Tamandua tetradactyla35.065.068369310019.0

This AT-rich composition (65.0%) is notable when compared to other Pilosa species like Choloepus didactylus (two-toed sloth), which has a higher GC content at 43.8% . This nucleotide composition may have implications for the protein's evolutionary history and functional properties within the mitochondrial genome.

What are the recommended storage and handling protocols for recombinant MT-ND4L?

For optimal stability and activity of recombinant Tamandua tetradactyla MT-ND4L, researchers should follow these protocols:

  • Store the protein at -20°C; for extended storage, maintain at -20°C or -80°C

  • Use a storage buffer consisting of Tris-based buffer with 50% glycerol, optimized for this protein

  • Avoid repeated freezing and thawing cycles as this can compromise protein integrity

  • Store working aliquots at 4°C for no more than one week

  • For reconstitution, briefly centrifuge the vial before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Consider adding 5-50% glycerol (final concentration) and aliquot for long-term storage

The shelf life is approximately 6 months for liquid form and 12 months for lyophilized form when stored at -20°C/-80°C .

How can MT-ND4L mutations be analyzed in relation to metabolic disorders?

Analyzing MT-ND4L mutations in relation to metabolic disorders requires a multi-faceted approach:

  • Mitochondrial DNA Sequencing: Utilize long-range PCR approaches followed by Next Generation Sequencing (NGS) to identify specific variants in MT-ND4L. Coverage should exceed 3500-fold to ensure accurate heteroplasmy detection .

  • Metabolomic Profiling: Integrate metabolomic measurements using platforms such as AbsoluteIDQ™ to establish metabolite profiles (including acylcarnitines, amino acids, sphingomyelins, and glycerophospholipids) that may be altered by MT-ND4L variants .

  • Association Analysis: Employ linear regression models to assess the relationship between MT-ND4L variants and metabolite ratios, adjusting for age and sex. Focus particularly on metabolite ratios rather than individual metabolites for increased statistical power .

  • Heteroplasmy Analysis: Quantify the degree of heteroplasmy in MT-ND4L variants and correlate with metabolic phenotypes. This is crucial as heteroplasmy levels can significantly impact the phenotypic expression of mitochondrial mutations .

Research has shown that variants in MT-ND4L, such as mt10689 G > A, are associated with multiple metabolite ratios, particularly those involving phosphatidylcholine diacyl C36:6 (PC aa C36:6), which has been linked to various patterns of fat distribution and metabolic disorders .

What methodologies are recommended for studying MT-ND4L in mitochondrial genome-wide association studies?

When conducting mitochondrial genome-wide association studies (mtGWAS) involving MT-ND4L, researchers should consider these methodological approaches:

  • Sample Collection and DNA Extraction: Extract DNA from peripheral blood mononuclear cells to ensure high-quality mitochondrial DNA for sequencing .

  • Sequencing Strategy: Implement a long-range PCR approach with highly processive polymerase mixtures and novel primer pairs specific to the mitochondrial genome. Process samples with Illumina® Nextera® XT and sequence on platforms such as Illumina® MiSeq™ for comprehensive coverage .

  • Data Analysis Pipeline:

    • Calculate metabolite ratios: For N single metabolites, analyze (N*(N-1))/2 ratios

    • Apply linear regression models: mtSNV ~ metabolite ratio + age + sex

    • Implement appropriate statistical corrections for multiple testing using Matrix Spectral Decomposition (matSpDlite)

    • Apply P-gain statistics to quantify the improvement in association strength when using ratios compared to single metabolites

  • Validation Approaches: Verify significant associations through replication in independent cohorts and functional studies in cell models to confirm the biological relevance of identified MT-ND4L variants .

This "inverted mtGWAS" approach, where genetic variants are used as outcome variables rather than predictors, has successfully identified associations between MT-ND4L variants and metabolic profiles .

What is the significance of the mt10689 G > A variant in MT-ND4L for metabolomic research?

The mt10689 G > A variant in MT-ND4L represents a critical target for metabolomic research due to its extensive associations:

  • Multiple Metabolite Associations: This variant is associated with 16 different metabolite ratios, making it the most common multi-associated mtSNV identified in comprehensive mtGWAS studies .

  • Phosphatidylcholine Metabolism: Notably, all 16 ratios associated with this variant involve phosphatidylcholine diacyl C36:6 (PC aa C36:6), suggesting a specific role in phospholipid metabolism regulation .

  • Metabolic Disorder Connections: PC aa C36:6 has been associated with:

    • Different patterns of fat concentration in the body

    • Visceral fat and liver fat content

    • Three metabolite ratios previously linked to Fat-Free Mass Index

  • Mechanistic Implications: The association between this variant and PC aa C36:6 levels suggests a potential mechanism through which MT-ND4L affects energy metabolism, possibly explaining pathways in the development of metabolic conditions .

Research approaches should include targeted analysis of this variant in populations with metabolic disorders, functional validation in cellular models, and longitudinal studies to assess how this variant affects disease progression over time .

What sequencing approaches are most effective for MT-ND4L analysis?

For optimal MT-ND4L analysis, researchers should implement the following sequencing methodology:

  • Long-Range PCR Amplification:

    • Use highly processive polymerase mixtures specifically designed for mitochondrial DNA

    • Employ novel primer pairs that specifically target the mitochondrial genome

    • Ensure complete coverage of the MT-ND4L region (297 bp)

  • Library Preparation and Sequencing:

    • Process amplicons with Illumina® Nextera® XT (catalog # FC-131-1096)

    • Utilize engineered Transposome™ technology to randomly fragment and tag amplicons

    • Sequence on platforms such as Illumina® MiSeq™ to achieve coverage exceeding 3500-fold on average

  • Variant Calling and Heteroplasmy Analysis:

    • Implement bioinformatic pipelines capable of detecting low-level heteroplasmy (typically >1%)

    • Apply appropriate filters to distinguish true variants from sequencing errors

    • Consider using multiple variant callers and establishing consensus calls for increased accuracy

  • Quality Control Measures:

    • Include appropriate reference standards

    • Implement sample replicates to assess reproducibility

    • Validate critical findings with alternative methods such as Sanger sequencing or digital PCR for heteroplasmy quantification

This NGS approach provides significantly deeper analysis of the mitochondrial genome and heteroplasmy identification than array-based genotyping of mitochondrial SNVs .

How should statistical analyses be designed for MT-ND4L metabolomic studies?

When designing statistical analyses for MT-ND4L metabolomic studies, researchers should consider:

  • Multiple Testing Correction:

    • Calculate the effective number of independent tests (Meff) using Matrix Spectral Decomposition (matSpDlite)

    • Apply the method of Li and Ji for correction factor determination

    • Consider a P-value threshold of 1.257545 × 10^-5 after Meff correction

  • P-Gain Statistics:

    • Implement P-gain to quantify the improvement in association strength when using ratios

    • Consider a ratio significant when P-gain > 151 (total number of metabolites analyzed)

    • P-gain = min(p(m1), p(m2)) / p(m1/m2), where p(m1) and p(m2) are P-values for single metabolites

  • Normality Assessment:

    • Test associations for both untransformed and log-scaled ratios

    • Use quantile-quantile plots to examine P-value distribution

    • Verify lambda (λ) values range between 0.93 and 1.26

This comprehensive statistical approach has successfully identified 404 mtSNVs with significant metabolite ratio associations at genome-wide significance levels .

How does MT-ND4L research contribute to understanding metabolic syndrome development?

MT-ND4L research has significant implications for understanding metabolic syndrome development through several key mechanisms:

  • Energy Metabolism Regulation: MT-ND4L, as a component of Complex I, plays a central role in oxidative phosphorylation. Changes in MT-ND4L gene expression have long-term consequences on energy metabolism and have been suggested to be a major predisposition factor for metabolic syndrome development .

  • Mitochondrial Dysfunction Pathway: Dysfunction of MT-ND4L may cause energy deficiency in cells, resulting in metabolic disorders such as obesity and diabetes. This establishes a direct mechanistic link between mitochondrial function and metabolic health .

  • Genetic Predisposition Factors: Several variants of human MT-ND4L have been associated with altered metabolic conditions, including:

    • Changes in BMI

    • Development of type 2 diabetes

    • Alterations in phospholipid metabolism, particularly involving PC aa C36:6

  • Research Approach for Metabolic Syndrome:

    • Conduct genetic association studies with MT-ND4L variants in diverse populations

    • Establish metabolomic profiles and correlate with MT-ND4L variants

    • Develop cell and animal models with altered MT-ND4L function to study metabolic effects

    • Design longitudinal studies to track how MT-ND4L variants affect disease progression

Understanding these relationships may enable the development of targeted interventions that address mitochondrial dysfunction in metabolic syndrome, potentially opening new therapeutic avenues for this increasingly prevalent condition .

What is the role of MT-ND4L mutations in Leber hereditary optic neuropathy?

MT-ND4L mutations play a significant role in Leber hereditary optic neuropathy (LHON), a mitochondrial disorder primarily affecting vision:

  • T10663C Mutation: A specific mutation in the MT-ND4L gene, T10663C (Val65Ala), has been identified in several families with LHON. This mutation changes a single protein building block (amino acid) in the NADH dehydrogenase 4L protein, replacing valine with alanine at position 65 .

  • Functional Consequences:

    • The Val65Ala substitution likely affects the structural integrity or functional properties of Complex I

    • This alteration may compromise energy production in retinal ganglion cells, which have high energy demands

    • The resulting mitochondrial dysfunction leads to the vision loss characteristic of LHON

  • Research Methodologies:

    • Genetic screening for T10663C and other MT-ND4L mutations in LHON patients

    • Functional characterization of mutant proteins in cellular models

    • Assessment of Complex I activity, ROS production, and ATP synthesis in mutant cells

    • Development of animal models expressing MT-ND4L mutations to study disease progression

  • Investigative Challenges:

    • Researchers have not fully determined the precise mechanisms by which MT-ND4L mutations lead to the selective vulnerability of retinal ganglion cells

    • The relationship between heteroplasmy levels and disease expression requires further investigation

    • Additional genetic and environmental factors that modify disease expression need identification

Understanding MT-ND4L's role in LHON could provide insights into mitochondrial dysfunction in neurodegenerative diseases more broadly and potentially inform therapeutic approaches for mitochondrial disorders .

How can MT-ND4L be studied in comparative evolutionary research?

MT-ND4L offers valuable insights for comparative evolutionary research through several analytical approaches:

  • Nucleotide Composition Analysis: Compare GC/AT content across species to identify evolutionary patterns. For example, Tamandua tetradactyla has 35.0% GC and 65.0% AT content, while Choloepus didactylus has 43.8% GC and 56.2% AT content, suggesting different selective pressures .

  • Molecular Evolution Rate Assessment:

    • Analyze synonymous vs. non-synonymous substitution rates to detect selection signatures

    • Utilize models such as GTR + I + G for MT-ND4L evolutionary analysis

    • Compare evolutionary rates across different mitochondrial genes (MT-ND4L shows distinct patterns compared to other mt genes)

  • Correlation with Life History Traits:

    • Examine relationships between MT-ND4L sequence characteristics and lifespan (Tamandua tetradactyla: 19.0 years vs. Choloepus didactylus: 36.8 years)

    • Investigate whether specific amino acid positions correlate with metabolic rate, body size, or environmental adaptations

  • Methodological Framework:

    • Sequence MT-ND4L from multiple species across diverse taxonomic groups

    • Align sequences using tools optimized for mitochondrial genes

    • Construct phylogenetic trees using maximum likelihood or Bayesian approaches

    • Apply molecular clock analyses to estimate divergence times

    • Correlate sequence features with ecological and physiological traits

This comparative approach can reveal how MT-ND4L has evolved in response to different metabolic demands across species and provide insights into the adaptive significance of mitochondrial gene evolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.