Recombinant Tamiami virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
252-485
Protein Length
Full Length of Mature Protein
Species
Tamiami mammarenavirus (isolate Rat/United States/W 10777/1964) (TAMV)
Target Names
GPC
Target Protein Sequence
SFFTWSLSDAVGNDMPGGYCLEKWMLIASQLKCFGNTAVAKCNLNHDSEFCDMLRLFDFN RKAIETLQNKTRSQLNIAINAINSLISDNLLMKNRVKELMDIPFCNYTKFWYVNHTKLNH HSLPRCWLVKNGSYLNESEFRNDWLLESDHLISEILSREYEERQGRTPLSLVDVCFWSTL FYTASIFLHLIRIPTHRHIVGEGCPKPHRLRADSTCACGLYKQKRRPLKWVRSN
Uniprot No.

Target Background

Function

This class I viral fusion protein mediates fusion between viral and host endosomal membranes, enabling nucleocapsid delivery into the cytoplasm. Membrane fusion is triggered by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved and functions as a signal peptide; it also remains as a component of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational GP1/GP2 cleavage, glycoprotein transport to the cell surface, virion formation, and acid pH-dependent cell fusion. It also interacts with the host receptor.

Database Links

KEGG: vg:6301274

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the Tamiami Virus Glycoprotein Complex (GPC) and what are its key components?

The Tamiami virus glycoprotein complex (GPC) is the envelope protein responsible for receptor binding and membrane fusion during viral entry. The GPC is initially synthesized as a precursor polyprotein that undergoes post-translational processing to form three subunits:

  • Stable Signal Peptide (SSP): Unlike conventional signal peptides that are cleaved and degraded, the SSP remains as an integral part of the mature GPC complex.

  • GP1: The receptor-binding subunit that mediates attachment to host cell receptors such as transferrin receptor 1 (TfR1).

  • GP2: The transmembrane fusion protein that facilitates membrane fusion between viral and cellular membranes.

The GPC precursor is cleaved by cellular proteases to form these three subunits, which remain non-covalently associated in the mature virion . This tripartite structure is unique to arenaviruses and plays a critical role in viral tropism and pathogenicity.

How is the GPC processed in mammarenaviruses?

The processing of the GPC in mammarenaviruses involves several key steps:

  • Initial synthesis as a polyprotein precursor with an N-terminal signal peptide (SSP)

  • Translocation into the endoplasmic reticulum lumen

  • Retention of the SSP (unlike conventional signal peptides that are cleaved and degraded)

  • Proteolytic cleavage by cellular proteases (likely the subtilase SKI-1/S1P) to generate mature GP1 and GP2 subunits

  • Assembly of the tripartite complex consisting of SSP, GP1, and GP2

  • Transport to the cell surface

  • Incorporation into budding virions

This processing is essential for producing a functional glycoprotein complex capable of mediating viral entry. Defects in GPC processing, as seen with certain mutations, can significantly impair viral infectivity .

What is the unique role of the Stable Signal Peptide (SSP) in arenavirus GPC?

The Stable Signal Peptide (SSP) in arenavirus GPC is unique among viral glycoproteins in that it:

  • Remains associated with the mature GP complex after cleavage, unlike conventional signal peptides

  • Contains two hydrophobic domains (h1 and h2) separated by a conserved loop region

  • Plays critical roles beyond typical signal peptide functions, including:

    • Facilitating proper GPC folding and processing

    • Modulating GP-mediated membrane fusion

    • Contributing to pH-dependent fusion activation

    • Potentially interacting with the transmembrane domain of GP2

Mutational studies in Pichinde virus (PICV), a model arenavirus, have identified several conserved residues in SSP that are essential for viral replication: K33, F49, and C57. The G2A mutation causes significant reduction in membrane fusion activity and viral attenuation both in vitro and in vivo .

How does the GPC mediate viral entry into host cells?

The GPC mediates a multi-step viral entry process:

  • Initial attachment: GP1 binds to cell surface receptors - primarily transferrin receptor 1 (TfR1) for pathogenic New World mammarenaviruses. Some viruses like TAMV-FL can also interact with heparan sulfate proteoglycans (HSPGs) as attachment factors .

  • Receptor-mediated endocytosis: Following receptor binding, the virus-receptor complex is internalized via endocytosis.

  • Endosomal trafficking: The virion is transported through the endosomal pathway.

  • pH-dependent conformational change: The acidic environment of late endosomes triggers a conformational change in the GPC.

  • Membrane fusion: The GP2 fusion peptide inserts into the endosomal membrane, bringing viral and cellular membranes into proximity and causing fusion.

  • Release of viral ribonucleoprotein complex into the cytoplasm.

The ability of TAMV GPC to use human TfR1 (hTfR1) is a critical determinant of its zoonotic potential. The recently discovered TAMV-FL strain shows enhanced ability to utilize hTfR1 compared to the reference strain (TAMV-Ref), suggesting greater potential for human infection .

What methods are available for studying GPC-mediated membrane fusion in vitro?

Several complementary techniques are employed to study GPC-mediated membrane fusion:

a) Syncytium Formation Assay

  • Methodology: Cells expressing GPC and GFP are exposed to low pH medium (typically pH 5) to trigger fusion.

  • Readout: Formation of multinucleated cells (syncytia) visualized by fluorescence microscopy.

  • Applications: Qualitative assessment of fusion activity.

  • Example protocol: Transfect 293T cells with eGFP plasmid together with GPC constructs, treat with pH-adjusted medium (pH 5) for 5 minutes, and observe after 12 hours of additional culture .

b) Luciferase-Based Fusion Assay

  • Methodology: Effector cells expressing GPC and target cells expressing T7 RNA polymerase are mixed. Upon fusion, T7 polymerase drives expression of a luciferase reporter.

  • Readout: Quantitative measurement of luciferase activity.

  • Applications: Quantitative comparison of fusion efficiency between different GPC constructs.

  • Example protocol: Transfect 293T cells with T7 promoter-driven firefly luciferase reporter and GPC constructs, mix with BSR-T7 cells, treat with pH-adjusted medium, and measure luciferase activity after 12 hours .

c) Pseudotyped Virus Particle (PV) Entry Assays

  • Methodology: Production of recombinant vesicular stomatitis virus (rVSV) or HIV-based particles displaying arenavirus GPC.

  • Readout: Reporter gene expression (typically GFP or luciferase) in target cells.

  • Applications: Assessment of receptor usage and entry efficiency.

  • Example protocol: Co-transfect 293T cells with three plasmids (HIV genome, GFP reporter, and GPC expression vector), collect and purify VLPs by ultracentrifugation, normalize by p24 content, and infect target cells .

These methods allow researchers to dissect the molecular determinants of GPC-mediated fusion and entry without requiring work with infectious virus.

How do mutations in the GP affect viral tropism and zoonotic potential?

Mutations in the GP can dramatically alter viral tropism and zoonotic potential, as demonstrated by comparative studies of TAMV strains:

Key Findings from TAMV-FL Research:

  • Receptor Usage: TAMV-FL, unlike the reference strain, can efficiently utilize human TfR1 (hTfR1), indicating enhanced zoonotic potential .

  • Adaptive Mutations: During passaging in human cells, TAMV-FL acquired two mutations in GP (N151K and D156N) that further enhanced viral fitness through multiple mechanisms:

    • Increased dependence on hTfR1

    • Enhanced binding to heparan sulfate proteoglycans

    • Altered pH threshold for membrane fusion

    • Modified endosomal trafficking pathway

  • Structural Context: These mutations likely map to the trimeric axis of GP, suggesting they modify inter-subunit interactions critical for fusion activation.

Experimental Approaches to Study Tropism:

  • Receptor Blocking Assays: Using monoclonal antibodies against TfR1 to assess receptor dependency.

  • Heterologous Receptor Expression: Testing viral entry in cells expressing TfR1 orthologues from different species.

  • Pseudotype Entry Assays: Comparing entry efficiency of pseudoviruses bearing different GP variants.

  • pH Dependence Studies: Determining optimal pH for fusion to understand endosomal escape mechanisms.

These findings illustrate how minimal genetic changes in GPC can significantly impact viral host range and support surveillance efforts to identify potentially zoonotic viral strains circulating in nature .

What techniques are available for producing recombinant GPC for structural and functional studies?

Several approaches are used to produce recombinant GPC for research purposes:

a) Expression Vector Systems

  • Mammalian Expression: The pCAGGS expression vector is commonly used for mammalian cell expression of GPC.

  • Applications: Functional studies, cell-surface expression, fusion assays.

  • Considerations: Provides proper post-translational modifications and processing but may have lower yield.

  • Protocol elements: Transfection of 293T cells followed by detection via Western blotting or flow cytometry for surface expression .

b) Pseudotyped Virus Production

  • VSV-Based Systems: Recombinant VSV with its own G protein replaced by arenavirus GPC.

  • HIV-Based Systems: Three-plasmid transfection system using pCMVRΔ8.91 (HIV genome minus packaging signal and envelope), pHR'GFP (packaging signal and reporter), and GPC expression vector.

  • Applications: Entry studies, neutralization assays, receptor usage determination.

  • Protocol details: Collection of supernatants from transfected cells, filtration, and purification by sucrose gradient ultracentrifugation .

c) Reverse Genetics for Authentic Virus Production

  • Methodology: Transfection of cells with plasmids encoding viral genomic segments (L and S segments for arenaviruses).

  • Applications: Production of authentic viruses with specific GPC mutations for in vitro and in vivo studies.

  • Example: BSRT7-5 cells (expressing T7 RNA polymerase) transfected with L and S plasmids containing either wild-type or mutant GPC sequences .

These complementary approaches allow researchers to study GPC at different levels, from isolated protein function to behavior in the context of infectious virus.

How do specific amino acid residues in the SSP contribute to GPC function?

Mutational analysis of conserved SSP residues in the Pichinde virus (PICV) model system has revealed their specific contributions to GPC function:

ResidueDomainEffect of Alanine SubstitutionFunctional ImpactViability
G2N-terminalReduced membrane fusionAttenuated in vitro and in vivoViable
N20h1 domainImpaired GP1/GP2 cleavage, reduced fusionAttenuated in vivo but not in vitroViable
K33Loop regionAbolished GPC-mediated entryEssential for viral life cycleNon-viable
N37h2 domainNormal fusion and growth in vitroReduced virulence in vivoViable
F49h2 domainAbolished GPC-mediated entryEssential for viral life cycleNon-viable
R55C-terminalNormal fusion and growth in vitroReduced virulence in vivoViable
C57C-terminalAbolished GPC-mediated entryEssential for viral life cycleNon-viable
  • Essential residues (K33, F49, C57): Mutations abolish viral entry and prevent generation of viable virus.

  • Fusion-critical residues (G2, N20): Mutations reduce membrane fusion activity and attenuate virulence.

  • Virulence factors (N37, R55): Mutations preserve in vitro functions but reduce virulence in animal models, suggesting roles beyond entry.

These results demonstrate that the SSP plays multiple roles in the viral life cycle, affecting not only the well-characterized function in membrane fusion but also other aspects of viral fitness that impact pathogenesis .

What is the relationship between GPC structure and pH-dependent membrane fusion?

The pH-dependent membrane fusion mechanism of arenavirus GPC involves complex structural rearrangements:

  • Pre-fusion conformation: The mature GPC exists in a metastable state with GP1 shielding the fusion peptide of GP2.

  • pH sensing mechanisms:

    • The SSP contains conserved histidine residues that likely serve as pH sensors

    • The interface between SSP and GP2 transmembrane domain is critical for pH-dependent activation

    • Specific residues in GP1 and GP2 contribute to maintaining the metastable pre-fusion state

  • Structural transitions:

    • Low pH triggers dissociation of GP1 from the complex

    • This allows GP2 to undergo conformational changes that expose the fusion peptide

    • The fusion peptide inserts into the target membrane

    • GP2 folds back on itself, bringing viral and cellular membranes into proximity

  • Role of specific mutations:

    • The N151K and D156N mutations in TAMV-FL GP affect the pH threshold for fusion

    • These mutations facilitate viral fusion at lower pH, resulting in viral egress from later endosomal compartments

    • This altered pH dependence may contribute to expanded host range

  • Experimental determination of pH threshold:

    • Syncytium formation assays at varying pH

    • Infection assays in the presence of endosomal acidification inhibitors

    • Direct measurement of viral escape from endosomes using fluorescently labeled particles

Understanding the structural basis of pH-dependent fusion is critical for developing entry inhibitors that could serve as broad-spectrum antivirals against pathogenic arenaviruses.

How can reverse genetics systems be used to study GPC function in the context of viral infection?

Reverse genetics systems provide powerful tools for studying GPC function within the complete viral life cycle:

Methodology:

  • Plasmid construction:

    • Creation of plasmids encoding the viral L and S genomic segments

    • Introduction of specific mutations in the GPC coding region of the S segment

    • Inclusion of T7 promoter sequences for efficient transcription

  • Virus rescue:

    • Transfection of BSRT7-5 cells (expressing T7 RNA polymerase) with L and S plasmids

    • Collection of supernatants at various timepoints post-transfection

    • Plaque assay to detect and isolate viable recombinant viruses

    • Sequence confirmation of recovered viruses by RT-PCR

  • Functional characterization:

    • Growth curve analysis in cell culture

    • Plaque size and morphology assessment

    • In vivo pathogenesis studies in animal models

Research applications:

  • Structure-function analysis: Determining the role of specific GPC residues in viral replication

  • Host range studies: Assessing how GPC mutations affect viral tropism

  • Pathogenesis mechanisms: Identifying virulence determinants

  • Vaccine development: Creating attenuated strains

  • Antiviral testing: Evaluating entry inhibitors against authentic virus

Key findings from PICV reverse genetics studies:

  • Mutations K33A, F49A, and C57A in SSP prevented recovery of viable virus, confirming their essential role

  • G2A mutation yielded viable but attenuated virus with reduced fusion activity

  • N20A, N37A, and R55A mutations produced viruses with distinct phenotypes in vitro versus in vivo

This approach allows researchers to directly connect molecular determinants in GPC to biological outcomes in viral replication and pathogenesis, providing insights that cannot be obtained through pseudotype or isolated protein studies alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.