Recombinant Tamias amoenus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tamias amoenus (Yellow-pine chipmunk) (Neotamias amoenus)
Target Names
Target Protein Sequence
MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLSPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, composed of heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of MT-CO2 in Tamias amoenus compared to other mitochondrial genes?

MT-CO2 represents an important mitochondrial gene that, similar to cytochrome b, can provide valuable insights into the evolutionary history of Tamias amoenus. Research on cytochrome b has revealed substantial geographic variation characterized by at least 12 well-supported clades corresponding to distinct mountain ranges in northwest North America . MT-CO2 analysis would likely complement these findings, potentially revealing similar phylogeographic patterns due to its comparable evolutionary rate. When designing studies, researchers should consider that mitochondrial genes like MT-CO2 have been proven effective at resolving underlying phylogenetic relationships at intraspecific levels, as demonstrated with cytochrome b in T. amoenus populations .

How does sequence divergence in MT-CO2 compare to the observed divergence in cytochrome b within Tamias amoenus populations?

Based on cytochrome b research, T. amoenus exhibits maximum uncorrected levels of intraspecific sequence divergence exceeding 7%, with particularly high divergence (6-7%) between distinct geographic clades . For MT-CO2 studies, researchers should anticipate potentially similar levels of sequence divergence, though the exact patterns may differ due to gene-specific evolutionary constraints. In designing comparative studies, it's essential to sample across the species' geographic range, including populations from different mountain ranges, to capture the full spectrum of genetic diversity. The high divergence observed in cytochrome b suggests that MT-CO2 may similarly reveal cryptic lineages within what is currently recognized as a single species.

What are the best protocols for extracting and isolating MT-CO2 DNA from Tamias amoenus tissue samples?

When extracting MT-CO2 DNA from T. amoenus tissue samples, researchers should follow standard mitochondrial DNA extraction protocols. Based on methodologies used for similar studies with cytochrome b, recommended approaches include:

  • Use of fresh tissue, frozen tissue (-80°C), or ethanol-preserved samples

  • Standard phenol-chloroform extraction or commercial DNA extraction kits optimized for mitochondrial DNA

  • Tissue selection preferably from muscle or liver, which contain higher mitochondrial content

  • Use of primers that specifically target the MT-CO2 gene region

The protocol should include quality control steps to assess DNA concentration and purity, with subsequent PCR amplification using MT-CO2-specific primers designed based on conserved regions identified from related sciurid species.

How can researchers differentiate between MT-CO2 sequences of Tamias amoenus and closely related chipmunk species?

Differentiating MT-CO2 sequences among Tamias species requires careful attention to species-specific nucleotide positions. Based on cytochrome b research, there are several considerations:

  • Sequence comparison should include multiple reference samples from verified T. amoenus specimens

  • Include outgroup sequences from related Tamias species such as T. ruficaudus, T. speciosus, and T. townsendii

  • Focus on diagnostic nucleotide positions that consistently differ between species

  • Perform phylogenetic analyses using maximum likelihood and Bayesian methods

Research with cytochrome b has shown that some currently recognized T. amoenus subspecies (T. a. canicaudus and T. a. cratericus) group with other Tamias species rather than with other T. amoenus populations . This suggests that MT-CO2 studies may also reveal similar taxonomic discrepancies, requiring careful comparison with multiple species.

What statistical models are most appropriate for analyzing MT-CO2 sequence variation in phylogeographic studies of Tamias amoenus?

For MT-CO2 sequence analysis in T. amoenus, researchers should employ multiple statistical approaches:

  • Model Selection: Use hierarchical likelihood ratio tests or Akaike Information Criterion to select the most appropriate model of nucleotide substitution. For cytochrome b in T. amoenus, the GTR+Γ model has proven effective, showing good fit between the model and data (P = 0.07) in parametric bootstrap tests .

  • Phylogenetic Reconstruction: Combine tree-building methods (Maximum Likelihood and Bayesian inference) with network approaches (Nested Clade Analysis) to detect both deep phylogenetic patterns and population-level processes.

  • Divergence Estimation: Calculate uncorrected p-distances between clades and employ molecular clock analyses calibrated with appropriate fossil dates.

The table below summarizes statistical model performance based on cytochrome b data, which may serve as a starting point for MT-CO2 analyses:

ModelLog LikelihoodParametersAICBootstrap Support
GTR+I+Γ-3380.4533n+1--
GTR+Γ-3381.5543nNot significantly worse (χ²₁=2.2, 0.5>P>0.1)Good fit (P=0.07)

How does recombinant MT-CO2 expression differ between subspecies of Tamias amoenus with divergent haplotypes?

Expression patterns of recombinant MT-CO2 likely vary among T. amoenus subspecies with divergent haplotypes. Based on cytochrome b research showing 12 well-supported clades with sequence divergence up to 7% , researchers should consider:

  • Amino acid substitutions that might affect protein folding and function

  • Possible differences in codon usage that could affect recombinant expression efficiency

  • Potential post-translational modifications specific to certain subspecies

For experimental design, researchers should:

  • Express multiple variant forms representing different geographic clades

  • Compare protein stability and activity under standardized conditions

  • Assess differences in protein-protein interactions, particularly with other respiratory complex subunits

These expression studies could provide functional insights into the adaptive significance of MT-CO2 variation across the species' range, complementing phylogenetic analyses.

What are the implications of MT-CO2 sequence variation for understanding mitochondrial introgression between Tamias species?

MT-CO2 sequence analysis can reveal patterns of mitochondrial introgression between Tamias species, similar to findings from cytochrome b studies. Research has shown that two currently recognized T. amoenus subspecies (T. a. canicaudus and T. a. cratericus) group with other Tamias species in phylogenetic analyses . When using MT-CO2 to study introgression:

  • Compare MT-CO2 phylogenies with those derived from nuclear markers to identify discordance indicative of introgression

  • Sample extensively from contact zones between T. amoenus and other Tamias species

  • Analyze linkage disequilibrium patterns between mitochondrial and nuclear loci

  • Estimate the timing and direction of introgression events

Understanding introgression patterns through MT-CO2 analysis contributes to resolving taxonomic uncertainties within Tamias and provides insights into hybrid zone dynamics and speciation processes in this genus.

How can researchers optimize heterologous expression systems for recombinant Tamias amoenus MT-CO2?

Optimizing heterologous expression of recombinant T. amoenus MT-CO2 presents several challenges due to its mitochondrial origin. Researchers should consider:

  • Expression System Selection:

    • Bacterial systems (E. coli): Simplest approach but may require codon optimization and solubility tags

    • Yeast systems (S. cerevisiae): Better for mitochondrial proteins but lower yield

    • Insect cell systems: Provide more appropriate post-translational modifications

  • Optimization Strategies:

    • Codon optimization based on expression host preferences

    • Addition of purification tags (His6, GST) that minimally affect protein function

    • Use of solubility-enhancing fusion partners (MBP, SUMO)

    • Expression at lower temperatures (16-20°C) to improve folding

  • Purification Approach:

    • Two-step purification combining affinity chromatography and size exclusion

    • Inclusion of appropriate detergents to maintain stability of this membrane protein

    • Verification of proper folding through circular dichroism spectroscopy

What are the best approaches for correlating MT-CO2 genetic variation with ecological parameters across the Tamias amoenus range?

To correlate MT-CO2 genetic variation with ecological parameters across the T. amoenus range, researchers should implement integrative approaches:

  • Geographic Information Systems (GIS) Analysis:

    • Map MT-CO2 haplotype distributions against ecological variables (climate, elevation, vegetation)

    • Identify environmental transition zones that correlate with genetic boundaries

  • Environmental Association Analysis:

    • Use multivariate approaches (RDA, CCA) to test associations between genetic variation and environmental variables

    • Employ landscape genetic approaches to quantify effects of geographic barriers

  • Selection Tests:

    • Compare nonsynonymous/synonymous substitution ratios (dN/dS) across the gene

    • Conduct McDonald-Kreitman tests to identify signatures of selection

This integrative approach can reveal whether MT-CO2 variation reflects neutral demographic processes or local adaptation to different environments, similar to the geographic structuring observed in cytochrome b data corresponding to distinct mountain ranges .

What are the critical quality control steps for ensuring accurate MT-CO2 sequencing from Tamias amoenus samples?

To ensure accurate MT-CO2 sequencing from T. amoenus samples, researchers should implement the following quality control procedures:

  • Sample Authentication:

    • Verify species identification through morphological examination

    • Confirm specimen identity through barcoding of multiple genetic markers

  • DNA Quality Assessment:

    • Quantify DNA using fluorometric methods (Qubit, PicoGreen)

    • Assess DNA integrity through gel electrophoresis

    • Verify mitochondrial DNA enrichment through qPCR targeting multiple mtDNA regions

  • Sequencing Quality Control:

    • Sequence both forward and reverse strands

    • Implement high coverage (>30×) for Next-Generation Sequencing approaches

    • Verify sequence quality through phred scores (Q30 or higher)

    • Manually inspect chromatograms for ambiguous base calls

  • Contamination Detection:

    • Include negative controls throughout extraction and amplification

    • Check sequences against databases to identify potential contamination

    • Compare results with reference sequences from verified specimens

These measures are particularly important given the high sequence divergence observed in mitochondrial genes of T. amoenus, where cross-contamination could lead to erroneous phylogenetic inferences .

How should researchers design primers for MT-CO2 amplification that account for the genetic diversity within Tamias amoenus?

When designing primers for MT-CO2 amplification in T. amoenus, researchers must account for the substantial genetic diversity observed in this species. Based on lessons from cytochrome b studies showing >7% sequence divergence , consider these approaches:

  • Primer Design Strategy:

    • Target conserved regions flanking MT-CO2 based on alignment of multiple Tamias species

    • Design degenerate primers that accommodate known polymorphic sites

    • Consider using nested PCR approaches with genus-level external primers and species-specific internal primers

  • Recommended Parameters:

    • Primer length: 18-25 nucleotides

    • GC content: 40-60%

    • Tm: 55-65°C with minimal difference between primer pairs

    • Avoid runs of identical nucleotides and primer self-complementarity

  • Validation Protocol:

    • Test primers on samples representing different geographic clades

    • Sequence PCR products to confirm target specificity

    • Optimize annealing temperatures through gradient PCR

Primer TypeTarget RegionConsiderations for T. amoenus
Conserved region primersRegions highly conserved across mammalsMay amplify nuclear pseudogenes
Tamias-specific primersRegions conserved within genus but different from other taxaPreferred for specific amplification
Clade-specific primersDesigned for specific T. amoenus cladesNecessary for highly divergent populations

What are the best practices for phylogeographic analysis of MT-CO2 data in Tamias amoenus?

Best practices for phylogeographic analysis of MT-CO2 data in T. amoenus should combine multiple analytical approaches:

  • Sampling Strategy:

    • Sample broadly across the species' geographic range

    • Include multiple individuals per population (n ≥ 5)

    • Target populations from different mountain ranges and elevation gradients

    • Include samples of related Tamias species as outgroups

  • Analytical Framework:

    • Combine tree-based methods (ML, Bayesian) with network approaches

    • Use nested clade analysis to distinguish between historical events and ongoing gene flow

    • Implement coalescent-based demographic analyses (Bayesian Skyline Plots, Extended Bayesian Skyline Plots)

  • Interpretation Guidelines:

    • Consider the maternal inheritance of MT-CO2 when interpreting population history

    • Compare results with nuclear markers to identify sex-biased dispersal or introgression

    • Interpret findings in the context of known geological events in the Northwest North America

This integrative approach has proven effective for cytochrome b studies in T. amoenus, revealing both deep phylogenetic divisions and signatures of different population-level processes structuring genetic variation .

How can researchers effectively compare MT-CO2 and cytochrome b data to enhance phylogenetic resolution in Tamias amoenus?

To effectively compare MT-CO2 and cytochrome b data for enhanced phylogenetic resolution in T. amoenus:

  • Data Integration Approaches:

    • Concatenate sequences for combined analysis after testing for congruence

    • Perform separate analyses and compare topologies to identify gene-specific patterns

    • Implement partitioned analyses that allow different evolutionary models for each gene

  • Comparative Metrics:

    • Compare genetic distances within and between clades for both genes

    • Assess node support values across phylogenies

    • Calculate consistency indices for each gene to evaluate homoplasy levels

  • Conflict Resolution:

    • Use SH tests or AU tests to statistically evaluate alternative topologies

    • Implement Bayesian concordance analysis for formal quantification of genealogical discordance

    • Investigate causes of discordance (incomplete lineage sorting, introgression, selection)

  • Combined Interpretation:

    • Use combined gene approach to resolve relationships among the 12+ clades identified in cytochrome b studies

    • Pay particular attention to the status of subspecies T. a. canicaudus and T. a. cratericus, which group outside T. amoenus in cytochrome b analyses

    • Develop integrated biogeographic hypotheses based on congruent patterns

What experimental controls should be included when expressing recombinant MT-CO2 for functional studies?

When expressing recombinant MT-CO2 for functional studies, researchers should implement these essential controls:

  • Expression Controls:

    • Positive control: Well-characterized mitochondrial protein known to express successfully

    • Negative control: Empty vector to assess background expression

    • Expression time course: Samples collected at multiple time points to determine optimal expression

  • Purification Controls:

    • Pre-induction sample to confirm absence of target protein

    • Flow-through from affinity columns to verify binding efficiency

    • Elution fractions analyzed by SDS-PAGE and Western blot to confirm identity

  • Functional Assay Controls:

    • Commercial cytochrome c oxidase as positive control

    • Heat-denatured recombinant protein as negative control

    • Concentration gradients to establish dose-response relationships

  • Specificity Controls:

    • Site-directed mutants targeting catalytic residues to confirm activity is specific to MT-CO2

    • Recombinant MT-CO2 from related species to assess species-specific differences

    • Inhibitor studies with known cytochrome c oxidase inhibitors

These controls ensure that observed functional properties are attributable to properly folded and active recombinant MT-CO2, rather than artifacts of the expression system or contaminants.

How does MT-CO2 variation in Tamias amoenus compare to patterns observed in other chipmunk species?

MT-CO2 variation patterns in T. amoenus likely show both similarities and differences compared to other chipmunk species. Based on cytochrome b studies:

  • Interspecific Comparisons:

    • T. amoenus shows exceptionally high intraspecific divergence (>7%) in cytochrome b compared to many other mammals

    • Similar patterns may be expected in MT-CO2, potentially exceeding the typical 2-3% divergence seen in other chipmunk species

  • Phylogeographic Structure:

    • The 12 well-supported geographic clades in T. amoenus cytochrome b data correspond to distinct mountain ranges

    • This suggests that MT-CO2 may similarly reflect the topographically complex landscape of northwest North America

  • Comparative Table of Mitochondrial Variation:

SpeciesCytochrome b Max DivergenceGeographic StructureExpected MT-CO2 Pattern
T. amoenus>7%12 distinct cladesSimilar high divergence with geographic structure
T. ruficaudus~7%East/west divisionLikely similar to cytochrome b pattern
T. minimusVariable (possibly polyphyletic)ComplexPotentially complex and non-monophyletic
T. townsendii groupLower divergenceLess structuredMore cohesive pattern than T. amoenus

Understanding these comparative patterns can provide insights into the evolutionary forces shaping mitochondrial diversity across the Tamias genus.

What are the implications of discordance between MT-CO2 and nuclear gene phylogenies in Tamias amoenus?

Discordance between MT-CO2 and nuclear gene phylogenies in T. amoenus would have several important implications:

  • Biological Mechanisms:

    • Mitochondrial introgression between Tamias species through hybridization

    • Sex-biased dispersal patterns (typically female philopatry in mammals)

    • Selective sweeps on mitochondrial haplotypes

    • Incomplete lineage sorting due to rapid radiation

  • Taxonomic Considerations:

    • Need for integrative taxonomy using multiple markers

    • Potential cryptic species or subspecies requiring taxonomic revision

    • Similar to how cytochrome b analysis revealed that subspecies T. a. canicaudus and T. a. cratericus may belong to different species

  • Research Applications:

    • Development of multi-locus approaches to accurately reconstruct species relationships

    • Use of coalescent-based species tree methods that accommodate gene tree discordance

    • Identification of hybrid zones for detailed investigation

This gene tree discordance highlights the importance of using multiple markers for robust phylogenetic inference in this taxonomically complex genus.

How can next-generation sequencing technologies enhance our understanding of MT-CO2 variation in Tamias amoenus populations?

Next-generation sequencing (NGS) technologies offer several advantages for studying MT-CO2 variation in T. amoenus:

  • Methodological Approaches:

    • Whole mitogenome sequencing to place MT-CO2 variation in genomic context

    • Targeted capture of mitochondrial genes across hundreds of individuals

    • Environmental DNA (eDNA) approaches to non-invasively sample populations

    • Single-molecule sequencing to directly examine heteroplasmy

  • Analytical Advancements:

    • Identification of rare variants present at low frequencies within populations

    • Detection of heteroplasmy (multiple mitochondrial haplotypes within an individual)

    • Improved phylogenetic resolution through greater sequence depth and coverage

    • Integration with nuclear genomic data for comprehensive evolutionary analysis

  • Conservation Applications:

    • High-throughput screening of population genetic diversity for conservation assessment

    • Monitoring of gene flow between isolated populations

    • Identification of populations with unique genetic composition for conservation prioritization

These NGS approaches would significantly expand upon the traditional Sanger sequencing methods used in previous cytochrome b studies of T. amoenus .

What are the most significant research gaps in our understanding of MT-CO2 in Tamias amoenus?

Despite advances in understanding mitochondrial variation in T. amoenus through cytochrome b studies, several significant research gaps remain regarding MT-CO2:

  • Comprehensive Sampling:

    • Need for range-wide sampling of MT-CO2 variation comparable to cytochrome b studies

    • Limited understanding of variation in understudied subspecies and geographic regions

    • Insufficient sampling across elevation gradients to assess adaptive variation

  • Functional Significance:

    • Unknown functional consequences of amino acid substitutions in MT-CO2

    • Limited understanding of selection pressures acting on this gene across different environments

    • Unclear relationship between MT-CO2 variation and metabolic performance

  • Evolutionary History:

    • Incomplete resolution of the relationship between MT-CO2 evolution and geological events

    • Limited understanding of hybridization dynamics and their impact on MT-CO2 distribution

    • Uncertain tempo and mode of evolution in MT-CO2 compared to other mitochondrial genes

Addressing these gaps would provide a more complete picture of the evolutionary history and functional significance of MT-CO2 variation in this species.

How might climate change impact the evolutionary trajectory of MT-CO2 in Tamias amoenus populations?

Climate change may significantly influence the evolutionary trajectory of MT-CO2 in T. amoenus populations through several mechanisms:

  • Range Shifts and Population Connectivity:

    • Upward elevation shifts might further fragment populations in montane habitats

    • Potential for secondary contact between previously isolated lineages

    • Changed dispersal patterns affecting gene flow between the 12+ distinct clades identified in cytochrome b studies

  • Selection Pressures:

    • Increased temperatures may alter selection on MT-CO2 variants that affect metabolic efficiency

    • Changed precipitation patterns might select for variants adapted to different energy requirements

    • Extreme weather events could cause bottlenecks, accelerating genetic drift

  • Monitoring Approaches:

    • Long-term genetic monitoring of MT-CO2 in sentinel populations across elevational gradients

    • Experimental studies examining metabolic performance of different MT-CO2 variants under projected climate conditions

    • Integration of genetic data with ecological niche modeling to predict population responses

These climate-induced changes could significantly reshape the current geographic structure of genetic variation in T. amoenus, potentially leading to loss of unique lineages or increased hybridization between previously isolated populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.