Recombinant Tamias bulleri Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tamias bulleri (Buller's chipmunk)
Target Names
Target Protein Sequence
MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLSPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAIPSLGLKTDAIPGRLN QATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multisubunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme a of subunit 1 to the active site (a binuclear center composed of heme a3 and CuB) in subunit 1. Here, molecular oxygen is reduced to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Tamias bulleri Cytochrome c oxidase subunit 2 (MT-CO2) and what is its significance in research?

Tamias bulleri Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded protein that forms part of the cytochrome c oxidase complex, which is the terminal enzyme of the respiratory electron transport chain. The protein is specifically derived from Buller's chipmunk (Tamias bulleri), a species within the chipmunk genus. The full-length protein consists of 227 amino acids with the UniProt accession number Q7IZ16 .

MT-CO2 has significant research value in several domains:

  • Evolutionary biology and phylogenetics, particularly for understanding relationships among Tamias species

  • Comparative mitochondrial genomics

  • Studies of protein structure and function in respiratory chain complexes

  • Molecular markers for species identification and population genetics

  • Research on mitochondrial adaptation to environmental conditions

The protein is also known by alternative names including Cytochrome c oxidase polypeptide II, and its gene is referred to as MT-CO2, COII, COXII, or MTCO2 in scientific literature .

How does MT-CO2 from Tamias bulleri compare with homologous proteins from other chipmunk species?

MT-CO2 from Tamias bulleri shows significant homology with the same protein from other chipmunk species, but with distinct sequence variations that reflect evolutionary relationships. Research using cytochrome oxidase subunit II (COII) sequences, in combination with cytochrome b (cyt b), has been instrumental in resolving the molecular phylogeny of the chipmunk genus Tamias, which currently comprises 25 recognized species .

Comparative analysis of MT-CO2 among Tamias species has revealed:

  • Clear differentiation between the three subgenera (Neotamias, Eutamias, and Tamias)

  • Extreme sequence divergences between these subgenera, suggesting ancient evolutionary separation

  • Regional variations that correlate with biogeographical distribution, particularly among southwestern U.S. taxa

  • Evidence of hybridization events between some species, such as T. ruficaudus and T. amoenus, resulting in mitochondrial DNA introgression

These comparative analyses highlight the utility of MT-CO2 as a molecular marker for understanding evolutionary relationships and historical hybridization events within this genus.

What are the optimal storage and handling conditions for recombinant Tamias bulleri MT-CO2?

For optimal stability and activity retention, recombinant Tamias bulleri MT-CO2 should be stored at -20°C in a Tris-based buffer with 50% glycerol. For extended storage periods, conservation at -80°C is recommended to minimize protein degradation .

Key handling recommendations include:

  • Avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity

  • For short-term use (up to one week), working aliquots can be maintained at 4°C

  • When preparing aliquots, use sterile technique and appropriate freezer-safe tubes

  • If using for enzyme activity assays, maintain the protein on ice when thawed

  • Consider adding protease inhibitors if working with crude preparations

Researchers should note that proper handling is essential for maintaining the structural integrity and functional properties of the recombinant protein, particularly for experiments requiring enzymatic activity or structural studies .

What methodologies are most effective for expressing and purifying recombinant Tamias bulleri MT-CO2?

Expressing and purifying mitochondrially-encoded membrane proteins like MT-CO2 presents several challenges that require specialized approaches. Based on established recombinant protein methodologies and specific considerations for MT-CO2, the following protocol recommendations are made:

Expression Systems:

  • Bacterial expression (E. coli): While economical, often results in inclusion bodies requiring refolding

  • Yeast expression (P. pastoris): Better for membrane proteins, provides proper post-translational modifications

  • Mammalian cell expression (HEK293): Highest fidelity for folding and modifications, but lower yield

Purification Strategy:

  • Affinity chromatography using histidine, FLAG, or other fusion tags

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for final polishing

For MT-CO2 specifically, the tag type may vary depending on the production process and specific experimental requirements . When designing expression constructs, researchers should consider:

  • Codon optimization for the host organism

  • Signal sequences for proper membrane insertion

  • Detergent selection for membrane protein extraction

  • Stabilizing agents in purification buffers

Researchers should validate the structural integrity of purified MT-CO2 using circular dichroism spectroscopy and functional assays before proceeding with downstream applications.

How can recombinant MT-CO2 be utilized in phylogenetic studies of chipmunk species?

Recombinant MT-CO2 can serve as a valuable tool in phylogenetic studies through several methodological approaches:

Sequence-Based Applications:

  • Direct sequencing of MT-CO2 from multiple species for maximum likelihood phylogenetic analysis

  • Combined analysis with other mitochondrial genes (e.g., cytochrome b) to improve phylogenetic resolution

  • Identification of conserved and variable regions that reflect evolutionary relationships

  • Analysis of selection pressures through Ka/Ks ratio calculations

Structure-Function Applications:

  • Comparative biochemical assays to detect functional adaptations across species

  • Site-directed mutagenesis to test the functional significance of species-specific amino acid substitutions

  • Structural biology approaches to understand how sequence differences affect protein folding and interaction

Research has demonstrated that MT-CO2 sequences, particularly when analyzed alongside cytochrome b sequences, can effectively resolve relationships among Tamias species and reveal complex evolutionary patterns, including instances of hybridization and mitochondrial DNA introgression between non-sister species such as T. ruficaudus and T. amoenus .

When designing phylogenetic studies using MT-CO2, researchers should:

  • Include representatives from all three subgenera (Neotamias, Eutamias, and Tamias)

  • Incorporate both morphological data and molecular data for comprehensive analysis

  • Account for potential mitochondrial introgression events that may confound species relationships

  • Use appropriate outgroups from related sciurid genera

What methodological approaches are recommended for studying potential hybridization and introgression events involving Tamias bulleri MT-CO2?

The detection and characterization of hybridization and introgression events involving MT-CO2 requires integration of multiple analytical approaches:

Recommended Methodology:

  • Multi-locus Sampling: Compare mitochondrial markers (MT-CO2) with nuclear markers to identify discordance patterns

  • Geographic Sampling: Sample across potential contact zones between species

  • Morphometric Analysis: Integrate morphological data, particularly diagnostic traits like bacular (os penis) variation in chipmunks

  • Statistical Approaches:

    • Nested clade analysis to distinguish between contemporary gene flow and historical events

    • Coalescent-based methods to estimate timing of introgression events

    • Bayesian assignment tests to identify hybrid individuals

Research on chipmunk species has revealed several instances of mitochondrial DNA introgression, with three cases consistent with recent or ongoing asymmetric introgression across morphologically defined secondary contact zones, and a fourth case potentially representing complete fixation of introgressed mitochondrial DNA from an ancient hybridization event .

When investigating hybridization involving Tamias bulleri, researchers should be particularly vigilant about:

  • Sampling design that encompasses potential contact zones with related species

  • The possibility of asymmetric introgression patterns

  • The need to differentiate between recent and ancient hybridization events

  • Integration of biogeographical data with molecular evidence

What techniques can be used to assess the functional activity of recombinant Tamias bulleri MT-CO2?

Assessing the functional activity of recombinant MT-CO2 requires specialized techniques that can measure its role in the cytochrome c oxidase complex. While drawing on methodologies developed for studying COX subunits in other systems, these approaches must be adapted for the specific properties of Tamias bulleri MT-CO2:

Enzyme Activity Assays:

  • Oxygen Consumption Measurements:

    • Polarographic method using Clark-type oxygen electrodes

    • High-resolution respirometry with titration of cytochrome c concentrations (2.5-30 μM)

    • Control measurements with KCN (0.5 mM) to inhibit COX activity and subtract non-specific oxygen consumption

  • Spectrophotometric Assays:

    • Monitoring the oxidation of reduced cytochrome c at 550 nm

    • Calculation of enzyme kinetics parameters (Km, Vmax) using Michaelis-Menten analysis

  • Assembly and Integration Analysis:

    • Blue native PAGE to assess incorporation into the COX complex

    • Immunoprecipitation to verify interactions with other COX subunits

    • Super-resolution microscopy to confirm mitochondrial localization

These functional assessments can be complemented with structural studies using techniques such as circular dichroism or limited proteolysis to verify proper folding of the recombinant protein.

How can MT-CO2 be incorporated into recombinant protein production systems for space biomanufacturing applications?

The integration of MT-CO2 into recombinant protein production systems for space biomanufacturing represents an innovative application at the intersection of protein biochemistry and space technology. Based on NASA's research on CO2-based manufacturing systems, the following methodological approach is proposed:

System Design Considerations:

  • Bioreactor Configuration:

    • Gas-permeable membrane bioreactor design to facilitate CO2 uptake

    • Dry salt formulations that can be rehydrated in space

    • Integration with carbon substrate derived from electrochemical CO2 conversion

  • Expression System Selection:

    • Bacterial or yeast hosts optimized for growth on acetate or ethanol (CO2-derived carbon sources)

    • Semi-autonomous bioprocessing systems requiring minimal crew intervention

    • Concentration and purification modules adapted for microgravity conditions

  • Process Optimization:

    • Biomass concentration methods compatible with microgravity

    • Protein purification protocols with minimal consumables

    • Quality control assays adaptable to space laboratory constraints

This application could potentially utilize MT-CO2 as a model protein for testing the efficiency of space biomanufacturing systems, particularly if it demonstrates thermal stability or other properties advantageous for space applications.

What CRISPR-Cas9 approaches can be applied to study the function of MT-CO2 in cellular models?

CRISPR-Cas9 technology offers powerful approaches for investigating MT-CO2 function through precise genetic manipulation. Drawing from methodologies developed for studying cytochrome c oxidase subunits, the following CRISPR-based strategies can be applied:

Gene Knock-Out Strategy:

  • gRNA Design and Selection:

    • Design multiple gRNA pairs targeting the MT-CO2 gene

    • Test efficiency using SURVEYOR assays or similar methods

    • Select optimal gRNA combinations for paired nickase approach to minimize off-target effects

  • Knock-Out Generation:

    • Transfect cells with expression plasmids containing selected gRNAs and Cas9-D10A nickase

    • Screen and isolate clonal populations

    • Verify knock-outs through sequencing and protein expression analysis

  • Rescue Experiments:

    • Re-introduce wild-type or mutant MT-CO2 to knock-out cells

    • Assess restoration of mitochondrial function

    • Compare effects of species-specific variants on cellular phenotypes

Functional Assessment of KO Models:

  • Respirometry to measure oxygen consumption rates

  • Assessment of mitochondrial membrane potential

  • Analysis of reactive oxygen species production

  • Measurement of ATP synthesis capacity

This approach can be particularly valuable for comparative studies of MT-CO2 function across different Tamias species to understand evolutionary adaptations in mitochondrial respiration .

What are the future research directions for Tamias bulleri MT-CO2 studies?

The study of Tamias bulleri MT-CO2 presents numerous opportunities for future research that span multiple disciplines and methodological approaches. Based on current knowledge and emerging technologies, several promising research directions include:

Evolutionary and Ecological Applications:

  • Comprehensive phylogenomic studies incorporating MT-CO2 and other markers across all Tamias species

  • Investigation of adaptive evolution in MT-CO2 related to environmental factors

  • Analysis of how climate change may impact genetic exchange between Tamias species

Structural and Functional Studies:

  • Cryo-EM structure determination of the complete cytochrome c oxidase complex containing Tamias bulleri MT-CO2

  • Comparative biochemical analysis across Tamias species to identify functional adaptations

  • CRISPR-engineered cellular models expressing MT-CO2 variants to assess functional consequences

Technological Applications:

  • Development of MT-CO2-based biosensors or biocatalysts

  • Integration into biomanufacturing systems, particularly for extreme environments

  • Application as molecular markers for biodiversity monitoring

Methodological Innovations:

  • Single-molecule sequencing approaches for detecting heteroplasmy and low-frequency variants

  • Development of non-invasive sampling techniques for endangered Tamias species

  • Machine learning algorithms to predict functional properties from sequence data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.