Recombinant Tamias canipes Cytochrome c oxidase subunit 2 (MT-CO2)

What is the structural composition of Recombinant Tamias canipes MT-CO2 protein?

Recombinant Tamias canipes Cytochrome c oxidase subunit 2 (MT-CO2) is a full-length protein consisting of 227 amino acids (position 1-227). The complete amino acid sequence is MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDSYMIPTSDLSPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML . The commercially available recombinant protein typically includes an N-terminal histidine tag to facilitate purification and detection in experimental settings.

The protein maintains the characteristic structural elements of cytochrome c oxidase subunit 2, which plays a crucial role in the electron transport chain. Its structure is highly conserved across species due to its essential function in cellular respiration, though specific amino acid variations exist between species that can affect binding kinetics with cytochrome c.

What is the functional role of MT-CO2 in the electron transport chain?

MT-CO2 functions as a critical component of cytochrome c oxidase (CcO), which is the terminal enzyme in the mitochondrial respiratory chain. The primary function of MT-CO2 is mediating the initial transfer of electrons from cytochrome c to the cytochrome c oxidase complex . This electron transfer is crucial for the production of ATP during cellular respiration.

The binding interaction between cytochrome c and CcO involves a complex of electrostatic and hydrophobic interactions. Research has demonstrated that MT-CO2 contains specific binding domains that interact with positively charged lysine residues surrounding the heme crevice of cytochrome c . This interaction facilitates proper orientation and electron transfer between the proteins. When cytochrome c binds to CcO, electrons move from cytochrome c to the Cu₁ center in MT-CO2, then to other metal centers within the oxidase complex, ultimately reducing molecular oxygen to water while contributing to the proton gradient necessary for ATP synthesis.

How conserved is MT-CO2 across different species, and what evolutionary patterns have been observed?

Despite its critical role in cellular respiration, MT-CO2 shows surprising levels of variation across species. Studies have documented extensive intraspecific nucleotide and amino acid variation in some species. For example, in the marine copepod Tigriopus californicus, researchers observed interpopulation divergence at the COII locus of nearly 20% at the nucleotide level, including 38 nonsynonymous substitutions . This suggests that despite functional constraints, evolutionary forces can drive significant variation in this protein.

Cytochrome c, which interacts directly with MT-CO2, has undergone three periods of accelerated evolution: early in vertebrate evolution, at the stem of anthropoid primates, and in the catarrhine stem leading to Old-World monkeys, apes, and humans . Research indicates that MT-CO2 has undergone parallel accelerated evolution, particularly in primate lineages, where binding site residues show greater evolutionary changes than other regions of the protein.

This co-evolution between cytochrome c and cytochrome c oxidase components suggests adaptation for specific interaction patterns, potentially driven by increased energy demands for brain development in primates or the need to regulate mitochondrial electron transfer to minimize reactive oxygen species formation in longer-lived species .

How do single-point mutations in MT-CO2 affect its interaction with cytochrome c?

Single-point mutations in cytochrome c oxidase subunit 2 can significantly alter the binding and electron transfer kinetics with cytochrome c. Research on similar systems has shown that mutations in critical residues can affect both the binding affinity (K_D) and the electron transfer rate constants.

For example, in studies examining the interaction between horse cytochrome c and bovine CcO, mutations in the acidic residues of CcO that interact with lysine residues on cytochrome c (such as E148Q, E157Q, D195N, and D214N in Rhodobacter sphaeroides CcO) significantly decreased the second-order rate constant for reaction with ruthenium-labeled cytochrome c . This indicates that these negatively charged residues are crucial for binding.

Similarly, the W143F mutation in R. sphaeroides CcO (equivalent to W104 in bovine) decreased the intracomplex electron transfer rate constant by 450-fold without affecting the dissociation constant or redox potential of Cu_A . This suggests that specific amino acid residues are directly involved in the electron transfer pathway rather than just binding.

When designing mutation studies for MT-CO2 from Tamias canipes, researchers should focus on:

• Conserved acidic residues likely involved in electrostatic interactions with cytochrome c

• Amino acids in the Cu_A binding region that may affect electron transfer

• Residues that differ between Tamias canipes and closely related species to understand species-specific adaptations

What experimental approaches are most effective for studying the binding kinetics between recombinant MT-CO2 and cytochrome c?

Several experimental approaches have proven effective for studying binding kinetics between cytochrome c oxidase subunits and cytochrome c:

• Laser Flash Photolysis with Ruthenium-Labeled Cytochrome c: This technique allows measurement of intracomplex electron transfer rates. By attaching a ruthenium complex to a specific position on cytochrome c (e.g., position 39), researchers can photo-induce electron transfer and monitor subsequent electron movement through the complex . For studying Tamias canipes MT-CO2, a similar approach using Ru-39-Cc would allow determination of:

  • Complex formation rate constants

  • Intracomplex electron transfer rates

  • Dissociation rate constants

• Surface Plasmon Resonance (SPR): This technique can provide real-time analysis of binding kinetics between immobilized MT-CO2 and cytochrome c under various conditions.

• Isothermal Titration Calorimetry (ITC): Useful for determining binding affinities, stoichiometry, and thermodynamic parameters of the interaction.

• Site-Directed Mutagenesis Combined with Kinetic Analysis: By creating specific mutants of either MT-CO2 or cytochrome c and analyzing changes in binding and electron transfer parameters, researchers can identify critical residues for interaction.

The research methodology should include controls for comparing binding parameters across species or with mutant proteins. For example, preparing the equivalent mutations in MT-CO2 as those studied in human/horse cytochrome c (positions analogous to 11, 12, 50, 83, and 89) would help understand the evolutionary significance of these residues in binding interactions .

How does phosphorylation affect MT-CO2 function in mitochondrial electron transport?

While direct information on MT-CO2 phosphorylation is limited in the provided search results, research on cytochrome c phosphorylation provides valuable insights into how post-translational modifications might affect the cytochrome c oxidase complex function.

Studies with phosphomimetic human cytochrome c mutants (T28E, S47E, Y48E, and Y97E) have demonstrated that phosphorylation can significantly alter interaction with cytochrome c oxidase . These phosphomimetic mutations increased the dissociation rate constant (k_d), decreased the formation rate constant (k_f), and increased the equilibrium dissociation constant (K_D) of the cytochrome c:CcO complex .

For MT-CO2 research, investigating potential phosphorylation sites would require:

• Bioinformatic Analysis: Identifying conserved serine, threonine, and tyrosine residues in Tamias canipes MT-CO2 that align with known phosphorylation sites in other species.

• Mass Spectrometry Analysis: To detect and quantify phosphorylation states of recombinant or native MT-CO2.

• Phosphomimetic Mutagenesis: Creating mutations that mimic phosphorylated states (typically S/T/Y to E substitutions) to study functional effects.

• Kinetic Analysis: Comparing binding and electron transfer parameters between wild-type and phosphomimetic mutants.

Phosphorylation likely serves as a regulatory mechanism for mitochondrial electron transport and membrane potential, potentially minimizing the formation of reactive oxygen species and supporting energy homeostasis during different physiological states.

What are the optimal conditions for expression and purification of recombinant Tamias canipes MT-CO2?

The optimal expression and purification of recombinant Tamias canipes MT-CO2 requires careful attention to several parameters:

Expression System:

• The protein is typically expressed in E. coli , which provides a cost-effective and scalable system for protein production.

• BL21(DE3) or similar expression strains are recommended for their reduced protease activity and tight control of expression.

Expression Conditions:

• Induction with IPTG at lower temperatures (16-20°C) overnight often improves protein folding.

• For membrane-associated proteins like MT-CO2, addition of 0.5-1% glycerol to the culture medium can improve protein stability.

Purification Protocol:

• Cell lysis using sonication or pressure-based methods in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10 mM imidazole.

• Affinity chromatography using Ni-NTA resin to capture the His-tagged protein.

• Washing with increasing imidazole concentrations (20-50 mM) to remove non-specifically bound proteins.

• Elution with higher imidazole concentrations (250-300 mM).

• Size exclusion chromatography for further purification if needed.

Storage Considerations:

• The purified protein should be stored at -20°C/-80°C .

• Repeated freeze-thaw cycles should be avoided .

• Working aliquots can be stored at 4°C for up to one week .

• Addition of 6% trehalose to the storage buffer (Tris/PBS-based buffer, pH 8.0) increases stability .

Reconstitution Protocol:

• Lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

• Addition of 5-50% glycerol (final concentration) is recommended for long-term storage .

What analytical techniques are most appropriate for assessing the quality and activity of purified MT-CO2?

Several analytical techniques should be employed to comprehensively assess the quality and activity of purified recombinant Tamias canipes MT-CO2:

1. Purity Assessment:

• SDS-PAGE to verify protein size and purity (>90% purity is expected)

• Western blotting using anti-His antibodies or specific MT-CO2 antibodies

• Mass spectrometry for precise molecular weight determination and potential post-translational modifications

2. Structural Integrity:

• Circular dichroism (CD) spectroscopy to assess secondary structure content

• Fluorescence spectroscopy to evaluate tertiary structure

• Thermal shift assays to determine protein stability

3. Functional Activity Assessment:

• Oxygen consumption assays with reconstituted cytochrome c oxidase complexes

• Spectrophotometric assays measuring the oxidation of reduced cytochrome c

• Polarographic assays using an oxygen electrode

4. Binding Studies:

• Surface plasmon resonance (SPR) to measure binding kinetics with cytochrome c

• Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

• Biolayer interferometry for real-time binding analysis

Activity Assay Protocol Example:

• Prepare reaction buffer: 25 mM potassium phosphate, pH 7.4, 100 mM KCl

• Add reduced cytochrome c (final concentration 10-50 μM)

• Add purified MT-CO2 (0.1-1 μM)

• Monitor decrease in absorbance at 550 nm (indicating cytochrome c oxidation)

• Calculate activity using extinction coefficient (ε₅₅₀ = 21.1 mM^-1cm^-1)

Data Interpretation Table:

What are the most effective methods for studying MT-CO2 protein-protein interactions in vitro?

Studying MT-CO2 protein-protein interactions, particularly with cytochrome c, requires specialized techniques that can capture binding dynamics and functional outcomes:

1. Co-Immunoprecipitation (Co-IP):

• Using anti-His antibodies to pull down His-tagged MT-CO2 along with bound interaction partners

• Reverse Co-IP with antibodies against potential binding partners

• Western blot analysis to identify co-precipitated proteins

2. Crosslinking Mass Spectrometry:

• Chemical crosslinking of MT-CO2 with interaction partners using reagents like BS3 or EDC

• Digestion of crosslinked complexes and analysis by LC-MS/MS

• Identification of crosslinked peptides to map interaction interfaces

3. Microscale Thermophoresis (MST):

• Label MT-CO2 with a fluorescent dye

• Measure changes in thermophoretic mobility upon binding to partners

• Determine binding affinities across a range of conditions

4. Laser Flash Photolysis with Ruthenium-Labeled Proteins:

• Similar to methods used in cytochrome c studies

• Allows measurement of binding and electron transfer kinetics

• Can determine both association and dissociation rate constants

5. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

• Identify regions of MT-CO2 that become protected from solvent upon binding

• Map the binding interface at peptide-level resolution

• Track conformational changes induced by binding

Experimental Design Considerations:

• Control for potential effects of the His-tag on interactions

• Include both positive controls (known interactions) and negative controls

• Test interactions across a range of pH, ionic strength, and temperature conditions to identify physiological optima

• Consider including detergents or lipids when studying membrane-associated interactions

Rate Constant Determination Protocol:

• Label cytochrome c with ruthenium complex at position 39

• Mix with MT-CO2 at low ionic strength

• Use laser excitation to initiate electron transfer

• Monitor absorbance changes with microsecond time resolution

• Fit data to appropriate kinetic models to extract rate constants for:

  • Complex formation (k_f)

  • Intracomplex electron transfer (k_et)

  • Complex dissociation (k_d)

How should researchers interpret evolutionary rate differences in MT-CO2 across different mammalian lineages?

Interpreting evolutionary rate differences in MT-CO2 across mammalian lineages requires careful analysis of sequence data in ecological and physiological context:

Analytical Approach:

• Sequence Alignment and Phylogenetic Analysis:

  • Align MT-CO2 sequences from diverse mammalian species

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Calculate evolutionary rates across different branches

• Identification of Selection Patterns:

  • Calculate dN/dS ratios to identify signatures of positive, negative, or neutral selection

  • Use branch-site models to detect episodic selection on specific lineages

  • Map amino acid changes onto protein structure to identify functional regions under selection

• Contextual Interpretation:
  When interpreting accelerated evolution in MT-CO2, consider parallel changes in interacting partners. Research on cytochrome c has shown three periods of accelerated evolution: early in vertebrate evolution, at the stem of anthropoid primates, and in the catarrhine lineage leading to Old World monkeys, apes, and humans . MT-CO2 would be expected to show coordinated evolutionary patterns due to the need for precise protein-protein interactions.

Potential Interpretations of Accelerated Evolution:

• Co-evolution with Binding Partners: Changes in MT-CO2 may compensate for mutations in cytochrome c to maintain functional interactions .

• Adaptation to Metabolic Demands: Increased brain size and energy requirements in primates may drive selection on electron transport chain components .

• Regulation of ROS Production: Longer-lived species may evolve modifications to minimize reactive oxygen species generation through fine-tuning electron transfer rates .

• Thermal Adaptation: Species in different thermal environments may evolve modifications to maintain function at their physiological temperatures.

Caution in Interpretation:
Researchers should avoid over-interpreting evolutionary patterns without functional validation. High evolutionary rates could reflect relaxed functional constraints rather than adaptive evolution. Combining sequence analysis with experimental testing of mutant proteins (as demonstrated with horse/human cytochrome c mutations ) provides more robust evidence for functional significance of evolutionary changes.

What considerations should be made when comparing experimental data from recombinant MT-CO2 versus native protein?

When comparing experimental data between recombinant Tamias canipes MT-CO2 and native protein, researchers should consider several factors that could influence experimental outcomes:

Structural Considerations:

• Presence of Affinity Tags: The His-tag on recombinant MT-CO2 may affect binding kinetics or structural properties, particularly if located near interaction surfaces.

• Post-translational Modifications: Native MT-CO2 may contain phosphorylation, acetylation, or other modifications absent in recombinant protein expressed in E. coli.

• Folding Differences: Recombinant protein expressed in E. coli may adopt slightly different conformations compared to protein folded in eukaryotic systems.

Functional Considerations:

• Lipid Environment: Native MT-CO2 functions in a specific lipid environment that may affect its activity compared to recombinant protein in detergent solutions.

• Protein Complex Assembly: In native systems, MT-CO2 functions as part of the larger cytochrome c oxidase complex, which may stabilize certain conformations.

• Redox State: Different expression and purification conditions may affect the redox state of metal centers involved in electron transfer.

Experimental Approach Recommendations:

• Control Experiments:

  • Test activity with and without affinity tag removal

  • Compare multiple expression systems (bacterial, insect, mammalian)

  • Include native protein (if available) as positive control

• Functional Reconstitution:

  • Incorporate recombinant MT-CO2 into liposomes with defined lipid composition

  • Reconstitute with other cytochrome c oxidase subunits to form functional complexes

  • Test activity in conditions mimicking physiological environment

• Data Normalization and Reporting:

  • Report relative activities rather than absolute values when comparing systems

  • Document all experimental conditions thoroughly for reproducibility

  • Validate findings across multiple protein preparations

Comparative Data Table Example:

How can researchers address inconsistencies in electron transfer kinetics data between different experimental approaches?

Researchers studying MT-CO2 may encounter inconsistencies in electron transfer kinetics when using different experimental approaches. Addressing these inconsistencies requires systematic analysis of methodological variables:

Common Sources of Inconsistency:

• Time Resolution Differences: Different techniques (spectroscopy, electrochemistry, laser flash photolysis) have different temporal resolutions that may capture different phases of the electron transfer process.

• Experimental Conditions: Temperature, pH, ionic strength, and buffer composition significantly affect electron transfer kinetics and may vary between experimental approaches.

• Protein Preparation Variability: Batch-to-batch variation in protein quality, purity, or modification state can introduce inconsistencies.

• Complex Formation State: Some techniques measure intracomplex electron transfer while others measure the complete reaction including complex formation and dissociation.

Systematic Approach to Reconciling Inconsistencies:

• Standardize Experimental Conditions:

  • Use consistent buffer compositions across all techniques

  • Control temperature precisely (±0.1°C)

  • Verify protein quality for each experiment using standard criteria

• Separate Rate-Limiting Steps:

  • Design experiments to distinguish between:

    • Complex formation rates (k_on)

    • Intracomplex electron transfer (k_et)

    • Complex dissociation rates (k_off)

  • Compare equivalent parameters across techniques

• Apply Multiple Techniques to the Same Samples:

  • Use laser flash photolysis, stopped-flow spectroscopy, and electrochemical methods on identical protein preparations

  • Develop mathematical models that reconcile data from different time scales

  • Identify systematic offsets between techniques using reference reactions

• Integrate Computational Approaches:

  • Use molecular dynamics simulations to establish theoretical expectations

  • Apply Marcus theory to calculate expected electron transfer rates based on distance and driving force

  • Compare experimental results with computational predictions to identify anomalies

Kinetic Analysis Framework:

• For intracomplex electron transfer, rates (k_et) follow Marcus theory and depend on distance between redox centers

• Rates typically range from 10³-10⁶ s^-1 for cytochrome c/CcO interactions

• The complete reaction includes:

  • Second-order binding (k_on) affected by ionic strength

  • First-order electron transfer (k_et) relatively insensitive to ionic strength

  • First-order dissociation (k_off) affected by redox state and ionic strength

By systematically addressing these factors and applying rigorous controls, researchers can reconcile apparent inconsistencies and develop more accurate models of MT-CO2 electron transfer kinetics.

What emerging technologies hold promise for studying MT-CO2 structure-function relationships?

Several cutting-edge technologies are poised to significantly advance our understanding of MT-CO2 structure-function relationships:

Cryo-Electron Microscopy (Cryo-EM):
Cryo-EM has revolutionized structural biology by enabling visualization of proteins without crystallization. For MT-CO2 research, this technology offers:

• Visualization of dynamic cytochrome c:MT-CO2 binding interfaces

• Structural analysis of MT-CO2 in different functional states

• Determination of how mutations affect binding orientation

• Visualization of complete cytochrome c oxidase complexes at near-atomic resolution

Time-Resolved X-ray Crystallography:
This technique allows researchers to capture structural changes during electron transfer:

• Visualization of conformational changes during the catalytic cycle

• Tracking electron movement through redox centers

• Identification of transient interaction states

Single-Molecule Techniques:

• Single-molecule FRET to measure distances between labeled components during electron transfer

• Optical tweezers to study binding forces between MT-CO2 and cytochrome c

• Single-molecule electrometry to detect electron movements in real-time

Advanced Computational Methods:

• Quantum mechanics/molecular mechanics (QM/MM) simulations to model electron transfer pathways

• Machine learning approaches to predict mutation effects on binding and function

• Molecular dynamics simulations of protein-protein interactions in membrane environments

Integrative Structural Biology:
Combining multiple experimental techniques with computational modeling:

• Integrating cryo-EM, crosslinking mass spectrometry, and computational modeling

• Correlating structural data with functional measurements from laser flash photolysis

• Creating comprehensive models of the entire electron transport chain

These technologies will enable researchers to address fundamental questions such as:

• How do specific amino acids contribute to electron transfer pathway efficiency?

• What conformational changes occur during the catalytic cycle?

• How do evolutionary changes in MT-CO2 affect its interaction with binding partners across species?

What are the most promising approaches for studying MT-CO2 function in cellular contexts?

Understanding MT-CO2 function in cellular contexts requires techniques that bridge the gap between in vitro biochemistry and cellular physiology:

Genome Editing Approaches:

• CRISPR/Cas9-mediated introduction of mutations corresponding to those in Tamias canipes MT-CO2

• Creation of cell lines expressing tagged versions of MT-CO2 for localization and interaction studies

• Generation of hybrid systems with MT-CO2 from different species to study evolutionary adaptations

Advanced Imaging Techniques:

• Super-resolution microscopy (STORM, PALM) to visualize mitochondrial complexes below diffraction limit

• FRET-based sensors to monitor electron transfer in living cells

• Correlative light and electron microscopy to connect functional and structural observations

Metabolic Analysis:

• Seahorse extracellular flux analysis to measure oxygen consumption and mitochondrial function

• 13C metabolic flux analysis to track metabolic pathways affected by MT-CO2 manipulation

• Real-time monitoring of mitochondrial membrane potential in response to MT-CO2 modifications

Proteomics Approaches:

• Proximity labeling techniques (BioID, APEX) to identify MT-CO2 interaction partners in situ

• Global phosphoproteomics to identify regulatory networks affecting MT-CO2 function

• Thermal proteome profiling to detect stability changes in protein complexes

Physiological Measurements:

• Assessment of reactive oxygen species production using fluorescent probes

• Calcium imaging to link MT-CO2 function to cellular calcium homeostasis

• Measurement of ATP production rates under different cellular states

Experimental Design Considerations:

• Use appropriate cell types that reflect the physiological context of interest

• Include proper controls (e.g., wild-type MT-CO2, enzymatically inactive mutants)

• Perform experiments under both basal and stressed conditions (e.g., hypoxia, nutrient deprivation)

• Correlate molecular changes with physiological outcomes

• Validate findings across multiple experimental systems

These approaches will help answer important questions about MT-CO2 function in living systems, including how evolutionary changes affect cellular energetics, how post-translational modifications regulate electron transport in response to cellular signals, and how MT-CO2 variants contribute to species-specific adaptations in energy metabolism.