Recombinant Tamias cinereicollis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tamias cinereicollis (Gray-collared chipmunk)
Target Names
Target Protein Sequence
MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLSPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML
Uniprot No.

Target Background

Function

Recombinant Tamias cinereicollis Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation via three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear active site in subunit 1. This site, composed of heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Recombinant Tamias cinereicollis Cytochrome c oxidase subunit 2 (MT-CO2) and what is its biological significance?

    Recombinant Tamias cinereicollis Cytochrome c oxidase subunit 2 (MT-CO2) is a laboratory-synthesized version of a mitochondrial protein naturally found in Gray-collared chipmunks (Tamias cinereicollis) . MT-CO2 functions as a critical component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation . This protein is essential for cellular respiration, catalyzing the reduction of oxygen to water using electrons from reduced cytochrome c . The recombinant form allows researchers to study specific aspects of mitochondrial function in controlled laboratory conditions without requiring tissue samples from endangered or protected species.

    The biological significance of MT-CO2 extends beyond basic respiration. It forms part of the binuclear copper A center (CuA) that accepts electrons from cytochrome c in the intermembrane space and transfers them through heme A to the active site . Research on this protein provides insights into evolutionary adaptations in mitochondrial function across different rodent species and environments.

  • What expression systems are most effective for producing functional Recombinant Tamias cinereicollis MT-CO2?

    The choice of expression system significantly impacts the functionality, yield, and structural integrity of Recombinant Tamias cinereicollis MT-CO2. Common expression systems include:

    Expression SystemAdvantagesDisadvantagesRecommended Application
    E. coliHigh yield, low cost, rapid growthLimited post-translational modifications, inclusion body formationInitial structural studies, antibody production
    Yeast (S. cerevisiae/P. pastoris)Moderate eukaryotic processing, higher yield than mammalianMay not fully replicate mammalian modificationsFunctional studies requiring partial activity
    Baculovirus-insect cellBetter post-translational modifications, good for membrane proteinsMore complex, moderate costStructure-function studies requiring proper folding
    Mammalian cell linesMost authentic modifications and foldingLowest yield, highest costHigh-fidelity functional studies, complex assembly

    For most applications studying the electron transport function of MT-CO2, the baculovirus-insect cell system provides the best balance between authentic protein structure and reasonable yield . This system allows proper formation of the copper-binding sites crucial for electron transfer activity. When using E. coli systems, researchers should include specialized refolding protocols and copper supplementation to achieve partial functionality.

  • What methods should be used to verify the purity and activity of Recombinant Tamias cinereicollis MT-CO2?

    Verification of Recombinant Tamias cinereicollis MT-CO2 quality requires multiple complementary approaches:

    Purity Assessment:

    • SDS-PAGE with Coomassie staining should show a predominant band at approximately 25.5 kDa with >90% purity

    • Western blotting using anti-MTCO2 antibodies confirms protein identity

    • Mass spectrometry verifies the exact molecular weight and can confirm amino acid sequence

    Structural Integrity:

    • Circular dichroism spectroscopy should verify expected secondary structure elements

    • UV-visible spectroscopy can detect proper incorporation of metal cofactors

    • Size-exclusion chromatography assesses aggregation state

    Functional Activity:

    • Cytochrome c oxidation assay measuring the decrease in absorbance at 550 nm

    • Oxygen consumption measurements using Clark-type electrodes

    • Electron transfer activity assessed through spectroscopic methods

    Researchers should establish baseline values for wild-type activity and compare recombinant protein performance. Typical functional recombinant preparations show at least 60-70% of the electron transfer activity observed in native mitochondrial isolates when properly reconstituted with other complex components .

  • How should Recombinant Tamias cinereicollis MT-CO2 be stored to maintain stability and activity?

    Optimal storage conditions for Recombinant Tamias cinereicollis MT-CO2 vary depending on the preparation type and intended use:

    Short-term storage (1-2 weeks):

    • Store at 4°C in Tris-based buffer (pH 7.4-7.8) containing 50% glycerol as indicated in the product information

    • Include protease inhibitors to prevent degradation

    • Maintain protein concentration above 0.5 mg/ml to prevent surface adsorption losses

    Long-term storage:

    • Store at -20°C or preferably -80°C in small aliquots to avoid repeated freeze-thaw cycles

    • Add cryoprotectants such as glycerol (typically 20-50%)

    • Seal under nitrogen atmosphere to prevent oxidation of metal centers

    Stability considerations:

    • Avoid repeated freeze-thaw cycles as this can lead to up to 30% activity loss per cycle

    • Monitor the absorbance spectrum periodically to verify cofactor integrity

    • If storing in detergent-solubilized form, use concentrations above the critical micelle concentration

    Properly stored preparations typically maintain >90% activity for 6 months at -80°C, but researchers should verify activity before critical experiments, especially for older preparations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.