Recombinant Tamias merriami Cytochrome c oxidase subunit 2 (MT-CO2)

What is the molecular structure of Tamias merriami MT-CO2 and how does it compare to other species?

The Tamias merriami MT-CO2 is a full-length protein consisting of 227 amino acids with a molecular weight of approximately 26 kDa. The complete amino acid sequence is:

MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS
YMIPTSDLNPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QATLTSTRPGLYYGQCSΕICGSNHSFMPIΝLELVPLKHFENWSSSML

When compared to closely related species such as Tamias bulleri, the sequence similarity is remarkably high, with only minor variations at specific amino acid positions. For example, T. bulleri has a substitution at position 157, where asparagine (N) is replaced by serine (S) . These subtle differences can be valuable for studying evolutionary adaptations in mitochondrial function across closely related species.

Comparative sequence analysis with more distant species such as Arvicanthis somalicus (Somali grass rat) reveals greater variance, particularly in regions associated with membrane interaction and substrate binding, which reflects evolutionary divergence while maintaining core functional domains .

What are the optimal storage and handling conditions for recombinant MT-CO2?

For optimal preservation of recombinant MT-CO2 protein activity, the following storage and handling protocols are recommended:

• Long-term storage: Store at -20°C or preferably -80°C in aliquots to avoid repeated freeze-thaw cycles .

• Buffer composition: Tris/PBS-based buffer with 50% glycerol (pH 8.0) provides optimal stability. Some preparations also include 6% trehalose as a cryoprotectant .

• Reconstitution: Briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

• Working aliquots: For ongoing experiments, working aliquots can be stored at 4°C for up to one week .

• Freeze-thaw sensitivity: Repeated freezing and thawing significantly decreases protein activity and should be avoided through proper aliquoting .

Following these guidelines ensures maximum retention of structural integrity and enzymatic activity for experimental applications.

How can researchers verify the purity and functional activity of recombinant MT-CO2?

Verification of recombinant MT-CO2 purity and functionality requires a multi-step analytical approach:

Purity Assessment:

• SDS-PAGE analysis: Commercial preparations typically demonstrate >90% purity by SDS-PAGE .

• Western blotting: Using anti-His tag antibodies for recombinant proteins with His-tags can confirm identity and integrity .

• Mass spectrometry: For precise molecular weight confirmation and detection of potential contaminants or degradation products.

Functional Activity Testing:

• Spectrophotometric assays: UV-spectrophotometer analysis can demonstrate the protein's ability to catalyze oxidation of its substrate, cytochrome c .

• Enzymatic activity measurement: Monitoring the rate of electron transfer from reduced cytochrome c to oxygen provides quantitative assessment of catalytic function.

• Infrared spectroscopy: Can be used to analyze structural integrity and binding capabilities of the recombinant protein .

When evaluating functionality, it's essential to compare activity to established standards and include appropriate positive and negative controls to ensure reliable interpretation of results.

What expression systems are commonly used for MT-CO2 production and what are their relative advantages?

Several expression systems are employed for recombinant MT-CO2 production, each with distinct advantages:

E. coli Expression System:

• Most commonly used for MT-CO2 production from various species including Tamias bulleri and Arvicanthis somalicus .

• Advantages: High yield, cost-effectiveness, scalability, and well-established protocols.

• Limitations: Potential for inclusion body formation and challenges with post-translational modifications.

• Specific strains like E. coli Transetta (DE3) have demonstrated successful expression of functional MT-CO2 .

Mammalian Expression Systems:

• Advantages: Better for maintaining native folding and post-translational modifications.

• Limitations: Lower yield and higher cost compared to bacterial systems.

Insect Cell Expression Systems:

• Advantages: Good compromise between bacterial and mammalian systems, offering both reasonable yield and proper post-translational modifications.

• Particularly useful when studying MT-CO2 interactions with other mitochondrial proteins.

The choice of expression system should be guided by the specific research objectives, required protein modifications, and downstream applications. For structural studies requiring high purity, bacterial systems often suffice, while functional interaction studies may benefit from eukaryotic expression systems.

What methodological approaches are most effective for studying MT-CO2 interactions with other respiratory chain components?

Investigating MT-CO2 interactions with other respiratory chain components requires sophisticated methodological approaches:

Co-immunoprecipitation (Co-IP):
This technique can identify direct protein-protein interactions between MT-CO2 and other respiratory chain components by using specific antibodies to precipitate protein complexes for analysis.

Bioluminescence Resonance Energy Transfer (BRET):
BRET allows for real-time monitoring of protein interactions in living cells by measuring energy transfer between labeled proteins when they come into close proximity.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
HDX-MS provides detailed information about protein interaction interfaces by measuring the exchange rates of hydrogen atoms in the protein backbone when exposed to deuterium-containing solvent.

Molecular Docking Analysis:
Computational approaches like those used to study interactions between cytochrome c oxidase and small molecules can be adapted to study MT-CO2 interactions . For example, researchers have used molecular docking to identify that allyl isothiocyanate (AITC) can form a hydrogen bond with specific amino acid residues (such as Leu-31) in cytochrome c oxidase subunit II, affecting its activity .

Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):
This technique separates intact protein complexes while maintaining their native state, allowing for the identification of MT-CO2-containing complexes in the respiratory chain.

The integration of multiple approaches provides the most comprehensive understanding of MT-CO2's role in respiratory chain assembly and function.

How can post-translational modifications of MT-CO2 be accurately analyzed and what is their functional significance?

Post-translational modifications (PTMs) of MT-CO2 can significantly impact its function and interactions. Research methodologies for analyzing these modifications include:

Mass Spectrometry-Based Approaches:

• Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for comprehensive identification of PTMs

• Selected reaction monitoring (SRM) for targeted quantification of specific modifications

• Electron transfer dissociation (ETD) for analysis of labile modifications

Site-Directed Mutagenesis:
Creating recombinant MT-CO2 variants with mutations at potential modification sites can help determine the functional significance of specific PTMs through comparative activity assays.

Functional Impact Analysis:
Modifications of MT-CO2 can affect:

• Protein stability and half-life

• Interaction with other respiratory chain components

• Catalytic efficiency in electron transfer

• Response to cellular stress conditions

The copper-binding region of MT-CO2 is particularly susceptible to oxidative modifications that can alter enzyme activity. Studying these modifications in recombinant proteins can provide insights into mitochondrial dysfunction mechanisms in various pathological conditions.

What are the current technical challenges in structural studies of MT-CO2 and how can they be addressed?

Structural determination of membrane proteins like MT-CO2 presents several technical challenges:

Challenge 1: Protein Solubility and Stability

• Solution: Optimization of detergent systems for solubilization while maintaining native structure

• Approach: Systematic screening of detergent types, concentrations, and buffer compositions

• Recent advances: Nanodiscs and styrene-maleic acid lipid particles (SMALPs) provide membrane-like environments for improved stability

Challenge 2: Crystal Formation for X-ray Crystallography

• Solution: Lipidic cubic phase (LCP) crystallization methods

• Approach: Systematic screening of crystallization conditions with varying lipid compositions

• Alternative: Electron microscopy for structural determination without crystallization

Challenge 3: Maintaining Functional State During Analysis

• Solution: Cryo-electron microscopy (cryo-EM) for visualization in near-native conditions

• Approach: Sample vitrification to preserve structural integrity

• Advantage: Allows visualization of different functional states

Challenge 4: Heterogeneity in Protein Preparations

• Solution: Advanced purification techniques including affinity chromatography with Ni²⁺-NTA agarose for His-tagged recombinant proteins

• Approach: Size exclusion chromatography for separation of different oligomeric states

• Quality control: Rigorous purity assessment through multiple analytical methods

Addressing these challenges requires an integrated approach combining optimized expression systems, advanced purification strategies, and state-of-the-art structural biology techniques.

How can researchers design experiments to study the role of MT-CO2 in mitochondrial dysfunction and disease models?

Designing robust experiments to investigate MT-CO2's role in mitochondrial dysfunction requires careful consideration of several methodological aspects:

1. Model System Selection:

2. Experimental Approaches:

• Gene Silencing/Knockout: Using siRNA or CRISPR-Cas9 to reduce or eliminate MT-CO2 expression

• Site-Directed Mutagenesis: Creating specific mutations that mimic those observed in mitochondrial diseases

• Pharmacological Interventions: Using compounds like allyl isothiocyanate (AITC) that interact with MT-CO2 to modulate its function

• Metabolic Stress Induction: Exposing cells to conditions that challenge mitochondrial function (hypoxia, oxidative stress)

3. Functional Readouts:

• Oxygen consumption rate measurements

• ATP production quantification

• Reactive oxygen species (ROS) detection

• Mitochondrial membrane potential assessment

• Cell viability and apoptosis assays

4. Data Integration:

Combining data from multiple experimental approaches provides the most comprehensive understanding of MT-CO2's role in disease. For example, correlating structural changes in mutant MT-CO2 with functional outcomes and disease phenotypes can establish causative relationships rather than mere associations.

What comparative analyses can reveal evolutionary adaptations in MT-CO2 across different species?

Comparative analyses of MT-CO2 across species can provide valuable insights into evolutionary adaptations related to environmental challenges and metabolic demands:

Sequence-Based Analyses:
Alignment of MT-CO2 sequences from various species reveals conservation patterns and species-specific variations. For example, comparing the sequences from Tamias merriami, Tamias bulleri, and Arvicanthis somalicus shows both highly conserved functional domains and variable regions that may reflect adaptive evolution .

Structure-Function Relationships:
By comparing amino acid variations with known functional domains, researchers can identify potential adaptive changes that affect:

• Catalytic efficiency

• Thermal stability

• pH optimum

• Interaction with other respiratory chain components

Phylogenetic Analysis:
Construction of phylogenetic trees based on MT-CO2 sequences can reveal:

• Evolutionary relationships between species

• Rates of evolutionary change

• Evidence of selective pressure

Molecular Adaptation Indicators:
Statistical analyses can identify sites under positive selection, which may indicate adaptive evolution in response to:

• Temperature adaptations (for species in different climates)

• Metabolic rate variations (for species with different activity levels)

• Oxygen availability (for species living at different altitudes)

Experimental Validation:
Recombinant proteins from different species can be produced and characterized to experimentally test hypotheses about adaptive changes. For example, comparing the thermal stability or catalytic efficiency of MT-CO2 from species living in different thermal environments can validate computational predictions about adaptive evolution.

What is the recommended protocol for purifying recombinant MT-CO2 with optimal yield and purity?

A robust purification protocol for recombinant His-tagged MT-CO2 typically involves the following steps:

1. Expression Optimization:

• Use E. coli expression systems such as Transetta (DE3) with IPTG induction

• Culture conditions: 37°C pre-induction, reduced to 18-22°C post-induction for 16-20 hours to enhance soluble protein production

2. Cell Lysis:

• Resuspend bacterial pellet in lysis buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, and 1 mg/ml lysozyme

• Sonication: 6-8 cycles of 30-second pulses with 30-second cooling intervals

• Centrifugation at 12,000 × g for 30 minutes at 4°C to separate soluble fraction

3. Affinity Chromatography:

• Load supernatant onto Ni²⁺-NTA agarose column pre-equilibrated with binding buffer

• Wash extensively with wash buffer containing 20-50 mM imidazole to remove non-specific binding proteins

• Elute with increasing imidazole gradient (100-250 mM)

4. Further Purification:

• Size exclusion chromatography to remove aggregates and ensure homogeneity

• Ion exchange chromatography as a polishing step if higher purity is required

5. Quality Control:

• SDS-PAGE analysis to confirm >90% purity

• Western blotting with anti-His antibodies to verify identity

• Activity assays to confirm functionality

6. Storage:

• Buffer exchange into storage buffer containing Tris/PBS with 50% glycerol

• Aliquot and store at -80°C to avoid freeze-thaw cycles

This protocol typically yields 40-60 mg of purified protein per liter of bacterial culture with >90% purity suitable for most research applications.

How can researchers accurately measure the enzymatic activity of recombinant MT-CO2?

Accurate measurement of MT-CO2 enzymatic activity is essential for functional studies and requires specific methodological considerations:

Spectrophotometric Cytochrome c Oxidation Assay:

• Prepare reduced cytochrome c by adding sodium dithionite to oxidized cytochrome c and removing excess reductant by gel filtration

• Reaction mixture: 10-50 μM reduced cytochrome c, 10-100 nM purified MT-CO2, in 50 mM phosphate buffer (pH 7.4)

• Monitor the decrease in absorbance at 550 nm, which indicates oxidation of reduced cytochrome c

• Calculate activity using the extinction coefficient of cytochrome c (Δε550 = 21.1 mM⁻¹cm⁻¹)

Oxygen Consumption Measurement:

• Use an oxygen electrode or optical oxygen sensors to directly measure oxygen consumption

• Reaction conditions: 20-100 nM MT-CO2, 20-50 μM reduced cytochrome c, in air-saturated buffer

• Record oxygen consumption rate over time and calculate specific activity

Controls and Considerations:

• Include enzyme-free controls to account for auto-oxidation of cytochrome c

• Test for inhibitor sensitivity (e.g., potassium cyanide) to confirm specificity

• Assess the effect of compounds like allyl isothiocyanate (AITC) that may modulate activity

• Perform assays at different temperatures to determine optimal conditions

Activity Calculation:
Activity is typically expressed as μmol cytochrome c oxidized per minute per mg of enzyme (U/mg) under standard conditions. Researchers have observed that recombinant MT-CO2 can catalyze the oxidation of cytochrome c substrate, confirming its functional activity despite being expressed in bacterial systems .