Recombinant Tamias palmeri Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tamias palmeri (Palmer's chipmunk) (Neotamias palmeri)
Target Names
Target Protein Sequence
MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLSPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, encompassing Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. MT-CO2 plays a vital role in Complex IV, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) of subunit 2 and heme a of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, comprising heme a3 and copper B (CuB), reduces molecular oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 and why is it significant in Tamias palmeri?

Cytochrome c oxidase subunit 2 (MT-CO2 or COII) is one of the core subunits of mitochondrial Cytochrome c oxidase (Cco), which plays a critical role in cellular respiration. This protein contains a dual core CuA active site and is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, a process crucial for ATP production . In Tamias palmeri, this protein is particularly significant because it represents a potential molecular marker for adaptation to the high-altitude environment of the Spring Mountains in Nevada, where this endemic chipmunk species is restricted to elevations typically above 2500m .

The significance of studying MT-CO2 in Tamias palmeri stems from both evolutionary and conservation perspectives. As demonstrated in research on other species, COII exhibits considerable interpopulation genetic variation despite its essential cellular function . Similar patterns may exist in T. palmeri populations, potentially providing insights into local adaptation processes and population differentiation within their limited range in the Spring Mountains.

How does MT-CO2 structure differ between Tamias palmeri and related chipmunk species?

While specific structural comparisons of MT-CO2 between Tamias palmeri and other chipmunk species are not directly reported in the provided literature, insights can be drawn from related research. Studies on chipmunk (Tamias) radiation have documented extensive mitochondrial DNA variation among related species, with approximately 16% of sequenced chipmunks exhibiting introgressed mtDNA . This suggests that MT-CO2, as a mitochondrial gene, may also show significant interspecific variation.

Based on observations from the marine copepod Tigriopus californicus, where interpopulation divergence at the COII locus reached nearly 20% at the nucleotide level (including 38 nonsynonymous substitutions) , we can hypothesize that similar patterns might exist between Tamias palmeri and closely related species such as Tamias panamintinus. The molecular evolution of COII in chipmunks likely reflects both functional constraints and selective pressures related to interactions with nuclear-encoded proteins.

What is the predicted molecular weight and structural characteristics of Tamias palmeri MT-CO2?

While the specific molecular weight of Tamias palmeri MT-CO2 has not been directly reported in the provided literature, comparative data from other species can inform predictions. In Sitophilus zeamais, the COII protein has a molecular mass of 26.2 kDa with a pI value of 6.37, encoding 227 amino acid residues from a 684 bp open reading frame .

For Tamias palmeri, we can predict similar characteristics, with expected molecular weight in the 26-28 kDa range for the native protein. When expressed as a recombinant protein with affinity tags (such as 6-His), the observed molecular weight on SDS-PAGE would increase accordingly. For instance, the recombinant COII from S. zeamais with fusion tags showed a molecular weight of approximately 44 kDa on Western blot analysis .

The protein likely contains conserved functional domains characteristic of cytochrome c oxidase subunit II, including the CuA binding site that facilitates electron transfer from cytochrome c to the catalytic center of the enzyme complex.

What are the recommended methods for isolating the MT-CO2 gene from Tamias palmeri tissue samples?

The isolation of MT-CO2 gene from Tamias palmeri tissue samples would follow standard molecular biology protocols for mitochondrial gene isolation, with specific considerations for field-collected samples. Based on chipmunk research methodologies, the following approach is recommended:

  • Tissue sampling: Obtain tissue samples (preferably ear clippings or small tissue biopsies) from live-trapped T. palmeri specimens. As documented in field studies in the Spring Mountains, aluminum folding traps (25 cm × 9 cm × 8 cm) baited with oat-peanut butter mixture have been successfully used for capturing this species .

  • DNA extraction: Extract total genomic DNA using commercial kits designed for small tissue samples. For samples where DNA quality might be compromised, modified extraction protocols with increased proteinase K digestion may improve yield.

  • PCR amplification: Design primers targeting the MT-CO2 gene based on conserved regions identified from aligned sequences of related Tamias species. The complete COII gene is typically around 684 bp in length, based on comparable species .

  • Sequencing and verification: Sequence the amplified products using Sanger sequencing and verify the identity through comparison with available Tamias sequences. For population studies, it may be necessary to sequence multiple individuals from different locations within the Spring Mountains range.

This approach has been successfully employed in other studies examining mitochondrial gene variation in Tamias species, yielding high-quality sequence data suitable for evolutionary and population genetic analyses .

What expression systems are most effective for producing recombinant Tamias palmeri MT-CO2?

Based on successful expression of recombinant COII from other species, the E. coli expression system represents the most effective approach for producing recombinant Tamias palmeri MT-CO2. Specifically, the following protocol is recommended:

  • Vector selection: Subclone the full-length coding sequence of Tamias palmeri MT-CO2 into the pET-32a expression vector or similar vectors containing T7 promoter systems. This vector system provides thioredoxin fusion tags that may enhance solubility of the recombinant protein .

  • Expression host: Transform the recombinant construct into E. coli Transetta (DE3) or other expression strains optimized for heterologous protein expression. These strains provide the T7 RNA polymerase necessary for high-level expression from T7 promoters.

  • Induction conditions: Induce protein expression using isopropyl β-d-thiogalactopyranoside (IPTG) at concentrations between 0.5-1.0 mM. Optimal induction conditions (temperature, duration) should be empirically determined, but initial trials at 30°C for 4-6 hours are recommended .

  • Protein purification: Purify the recombinant MT-CO2 protein using affinity chromatography with Ni²⁺-NTA agarose columns, taking advantage of the 6-His tag incorporated into the recombinant construct. Based on similar approaches with S. zeamais COII, expected protein yields are approximately 50 μg/mL .

This expression system has been demonstrated to produce functional recombinant COII capable of catalyzing the oxidation of cytochrome c substrate, suggesting that recombinant Tamias palmeri MT-CO2 produced through this approach would retain its enzymatic activity.

How can the functional activity of recombinant Tamias palmeri MT-CO2 be measured?

The functional activity of recombinant Tamias palmeri MT-CO2 can be assessed through several complementary approaches focusing on its electron transfer capability. Based on established methodologies for cytochrome c oxidase activity measurement, the following protocols are recommended:

  • Spectrophotometric assay: Measure the oxidation of reduced cytochrome c substrate by monitoring the decrease in absorbance at 550 nm. This approach provides a quantitative measure of the electron transfer function of MT-CO2 .

  • Polarographic measurement: Use an oxygen electrode to measure oxygen consumption rates during cytochrome c oxidation, providing direct measurement of the complete electron transfer to molecular oxygen.

  • Inhibitor sensitivity analysis: Evaluate the response of recombinant MT-CO2 activity to known cytochrome oxidase inhibitors such as cyanide or azide, which should inhibit activity in a dose-dependent manner.

  • Temperature and pH dependence: Characterize the optimal conditions for enzymatic activity by measuring activity across temperature and pH ranges, which may provide insights into adaptation to the high-altitude environment of Tamias palmeri.

For example, in studies with recombinant S. zeamais COII, UV-spectrophotometric and infrared spectrometer analyses demonstrated that the recombinant protein could catalyze the oxidation of cytochrome c substrate, confirming functional activity . Similar approaches would be suitable for Tamias palmeri MT-CO2 characterization.

How can recombinant Tamias palmeri MT-CO2 be used to study evolutionary relationships among chipmunk species?

Recombinant Tamias palmeri MT-CO2 can serve as a valuable tool for investigating evolutionary relationships among chipmunk species, particularly in the context of divergence with gene flow and adaptive evolution. The following research applications are possible:

  • Comparative biochemical analysis: Express recombinant MT-CO2 from multiple Tamias species and compare their biochemical properties, including substrate affinity, catalytic efficiency, and thermal stability. These functional comparisons can reveal adaptive changes that may have occurred during species diversification.

  • Tests of functional compatibility: Examine the functional interaction between recombinant MT-CO2 from different Tamias species and nuclear-encoded components of the electron transport chain. This can provide insights into the coevolution of mitochondrial and nuclear genes, which is particularly relevant given the high rates of mtDNA introgression (approximately 16%) observed among Tamias species .

  • Molecular dating and selection analysis: Use sequence data and recombinant protein characteristics to estimate divergence times and identify sites under positive selection. Previous studies on Tigriopus californicus COII identified approximately 4% of codons evolving under relaxed selective constraint (ω = 1) and several sites potentially under positive selection . Similar patterns may exist in Tamias palmeri MT-CO2, potentially correlating with adaptation to high-altitude environments.

Such evolutionary studies could help resolve taxonomic relationships within the Tamias radiation and provide insights into the molecular mechanisms underlying speciation and adaptation in this group.

What insights can MT-CO2 variation provide about Tamias palmeri adaptation to high-altitude environments?

Variation in MT-CO2 can provide significant insights into Tamias palmeri adaptation to high-altitude environments in several ways:

  • Oxygen affinity adaptations: High-altitude environments present challenges for efficient oxygen utilization. Amino acid substitutions in MT-CO2 that affect the efficiency of electron transfer or oxygen binding could represent adaptations to low oxygen availability in the high-elevation habitats of the Spring Mountains (above 2500m) .

  • Temperature compensation mechanisms: MT-CO2 variants might show different thermal optima or stability properties that compensate for temperature fluctuations at high altitudes. Comparative studies of enzyme kinetics across temperature ranges between recombinant MT-CO2 from Tamias palmeri and lower-elevation chipmunk species could reveal such adaptations.

  • Metabolic efficiency: Modifications in MT-CO2 that enhance ATP production efficiency would be particularly advantageous in high-altitude environments where resources may be limited. Such adaptations might be detected through detailed biochemical characterization of the recombinant enzyme.

The ecological distribution of Tamias palmeri, primarily in conifer forests at high elevations , suggests that this species has undergone physiological adaptation to these conditions. MT-CO2, as a critical component of energy metabolism, likely plays a role in this adaptation process.

How does MT-CO2 variation correlate with population structure in Tamias palmeri across its range?

While specific data on MT-CO2 variation within Tamias palmeri populations is not directly reported in the provided literature, insights can be gained from population studies of this species and from patterns observed in other organisms:

  • Geographic isolation effects: The Spring Mountains represent an isolated mountain range surrounded by desert, creating "sky island" conditions for Tamias palmeri. This isolation may have led to genetic differentiation between subpopulations occupying different mountain areas, potentially reflected in MT-CO2 sequence variation.

  • Habitat association patterns: Tamias palmeri distribution is strongly associated with specific forest types, particularly white fir/limber pine and ponderosa/white fir forests, with probability of occurrence increasing by factors of 2.05 and 1.84 respectively in these habitats . This habitat specificity might correlate with functional variants of MT-CO2 adapted to different microclimate conditions.

  • Population density correlation: Studies have documented variable population densities of Tamias palmeri across its range, with an average of 4.1 animals per hectare (range 3.5-33.9) . Higher-density populations might show different patterns of MT-CO2 variation due to stronger selective pressures or historical population dynamics.

Future research combining MT-CO2 sequencing with the established population monitoring protocols for Tamias palmeri could reveal how molecular variation in this gene correlates with population structure across the species' limited range in the Spring Mountains.

What are common challenges in expressing functional recombinant Tamias palmeri MT-CO2?

Several challenges may arise when attempting to express functional recombinant Tamias palmeri MT-CO2, based on experiences with similar proteins:

  • Inclusion body formation: Membrane-associated proteins like MT-CO2 often form insoluble inclusion bodies when overexpressed in E. coli. Strategies to address this include:

    • Using fusion tags that enhance solubility (thioredoxin, SUMO, or GST tags)

    • Lowering induction temperature (16-25°C)

    • Reducing IPTG concentration (0.1-0.5 mM)

    • Co-expressing molecular chaperones

  • Proper folding and cofactor incorporation: MT-CO2 contains copper centers essential for function. Ensuring proper incorporation of copper ions may require:

    • Supplementing growth media with copper salts

    • Using specialized E. coli strains with enhanced cofactor incorporation capabilities

    • Implementing in vitro reconstitution of copper centers after purification

  • Proteolytic degradation: As observed with the cbb3 cytochrome c oxidase in Rhodobacter sphaeroides, MT-CO2 may be susceptible to proteolytic degradation, particularly in the absence of stabilizing subunits . Adding protease inhibitors throughout the purification process and minimizing exposure to oxygen during purification may help preserve protein integrity.

These challenges can be addressed through systematic optimization of expression conditions and the use of appropriate fusion tags, as demonstrated in successful expression of recombinant COII from Sitophilus zeamais .

How can sequence variations between individual Tamias palmeri specimens affect recombinant protein studies?

Sequence variations between individual Tamias palmeri specimens can significantly impact recombinant protein studies in several ways:

  • Functional differences: Amino acid substitutions, particularly in catalytic regions or cofactor binding sites, may alter the enzymatic properties of recombinant MT-CO2. Studies on Tigriopus californicus revealed extensive intraspecific variation in COII (nearly 20% at the nucleotide level, including 38 nonsynonymous substitutions) , suggesting that similar variation might exist within Tamias palmeri populations.

  • Expression efficiency: Codon usage differences between variants may affect translation efficiency in heterologous expression systems. Optimizing codons for E. coli expression may be necessary for certain variants.

  • Stability and folding: Sequence variations can impact protein stability and folding kinetics, potentially requiring different buffer conditions or purification strategies for different variants.

To address these challenges, it is recommended to:

  • Sequence MT-CO2 from multiple individuals across the species' range

  • Create a consensus sequence for initial expression studies

  • Express multiple variants to compare functional properties

  • Document the specific specimen source for all published recombinant protein work

This approach acknowledges natural genetic variation while providing a framework for meaningful comparative studies.

What considerations are important when designing interaction studies between Tamias palmeri MT-CO2 and nuclear-encoded proteins?

When designing interaction studies between recombinant Tamias palmeri MT-CO2 and nuclear-encoded proteins, several important considerations should be addressed:

  • Coevolutionary relationships: Mitochondrial and nuclear genes encoding interacting proteins undergo coevolution. Studies of Tigriopus californicus demonstrated that COII codons may be under positive selection to compensate for amino acid substitutions in nuclear-encoded subunits . Therefore, interaction studies should ideally use proteins from the same population or individual to maintain natural interaction interfaces.

  • Functional compatibility assessment: Methods for assessing compatibility include:

    • Co-immunoprecipitation assays to detect physical interactions

    • Enzyme activity measurements to assess functional consequences of interactions

    • Binding affinity determinations using surface plasmon resonance or isothermal titration calorimetry

  • Structural analysis: Molecular docking approaches, similar to those used to study the interaction of allyl isothiocyanate with S. zeamais COII , can provide insights into binding interfaces and key residues involved in protein-protein interactions.

  • Experimental design considerations:

    • Express and purify interacting proteins using compatible systems

    • Ensure proper folding and cofactor incorporation for both proteins

    • Control buffer conditions to mimic physiological environment

    • Consider the impact of tags and fusion proteins on interaction dynamics

These considerations will help ensure that observed interactions reflect biologically relevant phenomena rather than experimental artifacts.

How can MT-CO2 studies contribute to conservation efforts for Tamias palmeri?

Studies of Tamias palmeri MT-CO2 can make significant contributions to conservation efforts for this endemic species in several ways:

  • Genetic diversity assessment: Sequencing MT-CO2 across the species' range can provide insights into genetic diversity and population structure, helping to identify genetically distinct subpopulations that may require specific conservation attention. This is particularly important given the restricted range of Tamias palmeri within the Spring Mountains of Nevada .

  • Adaptive potential evaluation: Functional studies of MT-CO2 variants can reveal adaptive potential in the face of climate change, which may disproportionately affect high-altitude species. Understanding the functional consequences of MT-CO2 variations can help predict how different populations might respond to changing environmental conditions.

  • Monitoring genetic health: Establishing baselines of MT-CO2 variation can provide a tool for long-term genetic monitoring of Tamias palmeri populations. Decreasing variation might signal population bottlenecks or inbreeding depression requiring management intervention.

  • Integration with existing monitoring: Current monitoring protocols for Tamias palmeri involve trapping transects and density estimates across different habitat types . Adding genetic sampling for MT-CO2 and other genes to these protocols would enhance their value for conservation planning with minimal additional field effort.

Such molecular data, when integrated with ecological monitoring, can provide a more comprehensive understanding of Tamias palmeri population viability and inform targeted conservation actions.

What is the relationship between MT-CO2 function and habitat specificity in Tamias palmeri?

The relationship between MT-CO2 function and habitat specificity in Tamias palmeri represents an intriguing area for research that connects molecular function to ecological distribution:

  • Habitat associations: Tamias palmeri shows strong habitat preferences, with occurrence probability increasing significantly in white fir/limber pine forests (by a factor of 2.05) and ponderosa/white fir forests (by a factor of 1.84), while decreasing in pinyon pine/juniper/mountain mahogany habitats (by a factor of 0.27) . These distinct preferences suggest potential physiological adaptations that may involve energy metabolism.

  • Altitudinal adaptation: MT-CO2, as a key component of the electron transport chain, may exhibit functional adaptations to the high-altitude environment (above 2500m) where Tamias palmeri is typically found . Specific amino acid substitutions might optimize oxygen utilization under lower partial pressure conditions at high elevations.

  • Temperature adaptation: Different forest types experience different temperature regimes. MT-CO2 variants might show optimized function at temperature ranges characteristic of preferred habitat types, contributing to habitat specificity.

  • Energetic demands: The metabolic requirements for survival in different forest types vary based on food availability, predator exposure, and thermal conditions. MT-CO2 variants that optimize energy production under specific ecological conditions would contribute to habitat specialization.

Research combining functional characterization of MT-CO2 variants with detailed habitat data could reveal molecular mechanisms underlying the observed habitat specificity of this species, providing insights into how metabolic adaptations contribute to ecological niche definition.

How do MT-CO2 sequence patterns compare between Tamias palmeri and the closely related Tamias panamintinus?

Comparative analysis of MT-CO2 sequences between Tamias palmeri and Tamias panamintinus would provide valuable insights into the evolutionary history and adaptive divergence of these closely related species:

  • Divergence patterns: While specific MT-CO2 sequence comparisons between these species are not directly reported in the provided literature, the two species have been analyzed using logistic regression to compare 174 Tamias palmeri and 94 Tamias panamintinus specimens within an isolated mountain range of the Basin and Range . This close geographic association suggests potential for historical gene flow that might be reflected in MT-CO2 sequence patterns.

  • Functional divergence: T. palmeri is primarily a high-elevation species in the Spring Mountains, while T. panamintinus typically occupies lower elevations in nearby mountain ranges. Comparative analysis of MT-CO2 sequences might reveal amino acid substitutions associated with adaptation to these different elevation profiles.

  • Introgression assessment: The chipmunk (Tamias) radiation shows high rates of mitochondrial DNA introgression, with approximately 16% of sequenced chipmunks exhibiting introgressed mtDNA . MT-CO2 sequence analysis could help determine if mitochondrial introgression has occurred between T. palmeri and T. panamintinus, potentially impacting the functional properties of MT-CO2 in either species.

  • Conservation implications: Understanding the genetic relationship between these species through MT-CO2 and other genetic markers can inform conservation strategies, particularly for the more range-restricted T. palmeri.

Such comparative analyses would contribute to our understanding of speciation processes in the Tamias genus while providing insights into the molecular basis of adaptation to different environmental conditions.

What are the most promising avenues for future research on Tamias palmeri MT-CO2?

Future research on Tamias palmeri MT-CO2 holds significant promise in several key areas:

  • Structure-function relationships: Determination of the three-dimensional structure of recombinant T. palmeri MT-CO2 through X-ray crystallography or cryo-electron microscopy would provide unprecedented insights into the molecular adaptations of this protein in a high-altitude endemic species.

  • Climate change response prediction: Investigating the thermal stability and functional properties of MT-CO2 variants across temperature ranges could help predict how T. palmeri might respond to warming temperatures in its high-elevation habitat.

  • Comparative genomics and transcriptomics: Expanding beyond MT-CO2 to examine the entire mitochondrial genome and associated nuclear genes in T. palmeri would provide a more comprehensive understanding of mitonuclear coevolution in this species.

  • Population genomics: Applying next-generation sequencing approaches to sample MT-CO2 and other genes across the entire range of T. palmeri would reveal fine-scale population structure and adaptive genetic variation, informing conservation strategies.

  • Functional ecology: Correlating MT-CO2 variants with fitness parameters, metabolic rates, and habitat utilization patterns would bridge the gap between molecular function and ecological performance.

These research directions would not only advance our understanding of T. palmeri biology but also contribute to broader knowledge of how metabolic adaptations facilitate ecological specialization in montane mammals.

What standardized protocols should be established for consistent research on Tamias palmeri MT-CO2?

To ensure consistency and comparability across studies, the following standardized protocols for Tamias palmeri MT-CO2 research are recommended:

  • Sample collection and handling:

    • Standardized tissue sampling methods (ear clips or buccal swabs)

    • Consistent DNA/RNA preservation protocols

    • Detailed metadata collection including precise location (GPS coordinates), habitat type, elevation, and morphometric data

  • Genetic analysis:

    • Standard primer sets for MT-CO2 amplification

    • Sequencing protocols covering the complete coding sequence

    • Consistent approaches for haplotype determination and nomenclature

  • Recombinant protein expression:

    • Standardized expression vectors and host systems

    • Optimized induction and purification protocols

    • Quality control metrics for protein purity and activity

  • Functional assays:

    • Standardized enzymatic activity measurements

    • Consistent buffer conditions and temperature parameters

    • Reference standards for comparative analyses

  • Data reporting and sharing:

    • Deposition of all sequences in public databases

    • Sharing of recombinant protein constructs through repositories

    • Standardized formatting for activity data to facilitate meta-analyses

Establishing these protocols would facilitate collaboration among researchers and enable meaningful comparisons across studies, advancing our collective understanding of T. palmeri MT-CO2 biology and its evolutionary significance.

How might emerging technologies enhance our understanding of MT-CO2 function in Tamias palmeri?

Emerging technologies offer exciting opportunities to deepen our understanding of MT-CO2 function in Tamias palmeri:

  • CRISPR-Cas9 cell culture models: Developing cell lines where endogenous MT-CO2 is replaced with Tamias palmeri variants would allow for controlled studies of functional effects in cellular contexts.

  • Single-molecule enzymology: Applying techniques such as total internal reflection fluorescence microscopy to study individual MT-CO2 molecules would reveal heterogeneity in enzymatic properties and provide insights into the molecular dynamics of electron transfer.

  • Nanoscale respirometry: Utilizing microfluidic devices for high-precision measurement of oxygen consumption in mitochondria containing T. palmeri MT-CO2 would enable detailed characterization of respiratory efficiency under varying conditions.

  • In silico molecular dynamics: Advanced computational modeling of MT-CO2 structure and interactions with other respiratory complex components would reveal the atomic-level mechanisms underlying functional adaptations.

  • Environmental DNA monitoring: Developing eDNA approaches for detecting and quantifying T. palmeri MT-CO2 sequences in environmental samples could revolutionize population monitoring without the need for trapping.

  • Portable sequencing technologies: Field-deployable sequencing platforms would enable real-time genetic monitoring of T. palmeri populations, facilitating rapid conservation responses to genetic changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.