Recombinant Tamias quadrimaculatus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Tamias quadrimaculatus Cytochrome c Oxidase Subunit 2 (MT-CO2) is a protein expressed in E. coli and fused to an N-terminal His tag . It is a recombinant form of the Cytochrome c oxidase subunit 2 (MT-CO2) protein from the Tamias quadrimaculatus, also known as the Long-eared chipmunk . Cytochrome c oxidase is a crucial enzyme complex in the mitochondrial respiratory chain .

Protein Information

The recombinant protein is a full-length Tamias quadrimaculatus Cytochrome c Oxidase Subunit 2(Mt-Co2) Protein, with the UniProt accession number Q9G5S9 . It consists of 227 amino acids (1-227aa) and is fused to an N-terminal His tag to facilitate purification and detection . Similar recombinant proteins are available for other species of Tamias, such as Tamias cinereicollis , Tamias dorsalis , Tamias palmeri , and Tamias canipes .

Function and Significance

Cytochrome c oxidase (Complex IV) is the terminal enzyme of the electron transport chain, which is essential for cellular energy production through oxidative phosphorylation . The MT-CO2 subunit plays a critical role in the electron transfer and proton pumping activities of the enzyme complex . Recombinant forms of this protein are valuable for research purposes, including:

  • Studying the structure and function of Cytochrome c oxidase.

  • Developing antibodies for detecting MT-CO2.

  • Investigating the role of MT-CO2 in various physiological and pathological processes.

Expression and Purification

The recombinant MT-CO2 protein is expressed in E. coli, a commonly used system for producing recombinant proteins . The His tag allows for easy purification of the protein using affinity chromatography .

Applications in Research

While specific research findings directly utilizing recombinant Tamias quadrimaculatus MT-CO2 are not available, recombinant proteins of this kind are generally used in several research areas:

  • Structural Biology: To determine the crystal structure of the protein and understand its mechanism of action.

  • Biochemistry: To study the enzyme kinetics and interactions with other proteins or molecules.

  • Immunology: To generate antibodies for use in immunoassays and Western blotting.

  • Cell Biology: To investigate the role of MT-CO2 in mitochondrial function and cellular metabolism.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tamias quadrimaculatus (Long-eared chipmunk)
Target Names
Target Protein Sequence
MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMVPTSDLSPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, composed of heme a3 and CuB, reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does Tamias quadrimaculatus MT-CO2 compare structurally with other chipmunk species?

Comparative analysis of MT-CO2 across different Tamias species reveals high sequence conservation, reflecting the protein's essential role in oxidative phosphorylation. Below is a comparison of key features between various chipmunk species:

SpeciesProtein LengthUniProt IDKey Distinguishing ResiduesSimilarity to T. quadrimaculatus
T. quadrimaculatus (Long-eared chipmunk)227 aaQ9G5S9V93Reference sequence
T. cinereicollis (Gray-collared chipmunk)227 aaQ7IZ14I9399.6% identity
T. palmeri (Palmer's chipmunk)227 aaQ7IZ01I9399.6% identity
T. dorsalis (Cliff chipmunk)227 aaQ7IZ11I9399.6% identity

The amino acid sequences are nearly identical across these species, with the most notable variation occurring at position 93, where T. quadrimaculatus has a valine (V) while the other species have isoleucine (I). This minor variation represents a conservative substitution that likely doesn't significantly alter protein function but serves as a useful marker for evolutionary studies .

What expression systems are most effective for producing recombinant MT-CO2?

E. coli is the predominant expression system used for recombinant production of MT-CO2. The commercially available recombinant proteins are expressed in E. coli with an N-terminal His-tag to facilitate purification .

Key considerations for expression:

  • Codon optimization: The mitochondrial genetic code differs from the standard code; therefore, codon optimization is essential for efficient expression in bacterial systems.

  • Expression vector selection: Vectors with strong promoters (T7, tac) are recommended for high-level expression.

  • Host strain selection: BL21(DE3) or Rosetta strains are preferred for expression of membrane proteins.

  • Induction conditions: Optimal conditions typically include:

    • IPTG concentration: 0.5-1.0 mM

    • Post-induction temperature: 16-25°C (lower temperatures often yield better results for membrane proteins)

    • Induction time: 16-20 hours

  • Solubilization strategy: As MT-CO2 is a membrane protein, detergent solubilization is critical for maintaining proper folding and function.

What are the recommended protocols for purification and storage of recombinant MT-CO2?

Purification of His-tagged MT-CO2 involves several critical steps to ensure high purity while maintaining protein integrity:

  • Lysis and solubilization:

    • Cell pellets should be resuspended in a Tris/PBS-based buffer (pH 8.0)

    • Lysis is typically performed by sonication or high-pressure homogenization

    • Addition of mild detergents helps solubilize the membrane protein

  • Immobilized metal affinity chromatography (IMAC):

    • Ni-NTA or TALON resin is commonly used

    • Initial binding in the presence of 20-50 mM imidazole to reduce non-specific binding

    • Step-wise or gradient elution with increasing imidazole concentration (250-500 mM)

  • Size exclusion chromatography:

    • Optional polishing step to remove aggregates and improve homogeneity

    • Buffer typically contains 20 mM Tris-HCl, 150 mM NaCl, pH 8.0, with appropriate detergent

  • Storage conditions:

    • Lyophilized powder form provides maximum stability

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Brief centrifugation prior to opening is recommended to bring contents to the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C

    • 50% glycerol is the default concentration used by commercial suppliers

How can recombinant MT-CO2 be used in functional enzymatic assays?

Recombinant MT-CO2 can be incorporated into several assay types to evaluate different aspects of cytochrome c oxidase function:

  • Oxygen consumption assays:

    • Clark-type oxygen electrodes can measure oxygen consumption rates

    • Reaction mixtures typically contain 50 mM potassium phosphate buffer (pH 7.4), reduced cytochrome c, and reconstituted MT-CO2

    • Oxygen consumption is recorded continuously and rates calculated from the slopes

  • Spectrophotometric assays:

    • Based on the oxidation of reduced cytochrome c (550 nm)

    • Reaction mixture contains 50 mM potassium phosphate buffer (pH 7.4), 0.5 mM DETAPAC, and appropriate amounts of recombinant cytochrome c oxidase (typically 1-10 pmol)

    • Activity is monitored as the decrease in absorbance at 550 nm

  • H2O2 generation measurement:

    • Using the Amplex Red/HRP system to detect H2O2 formation

    • This assay allows quantification of H2O2 produced during enzymatic reactions

    • Standard reaction mixtures contain 50 mM potassium phosphate buffer (pH 7.7), 1.0 mM sodium azide, and 0.5 mM DETAPAC

    • The reaction is initiated by adding NADPH and an NADPH-regenerating system

    • H2O2 is detected by adding Amplex Red and horseradish peroxidase after terminating the enzyme reaction with acetonitrile

What are the methodological considerations for comparative studies using MT-CO2 from different Tamias species?

When conducting comparative studies of MT-CO2 across different Tamias species, researchers should consider:

  • Standardization of expression and purification protocols:

    • Use identical expression systems, vector constructs, and purification methods

    • Maintain consistent buffer compositions and pH values

    • Verify protein concentration using the same method (Bradford, BCA, or UV absorbance)

  • Quality control metrics:

    • Confirm purity (>90%) via SDS-PAGE for all samples

    • Verify folding using circular dichroism spectroscopy

    • Assess oligomeric state using size exclusion chromatography or native PAGE

  • Activity normalization:

    • Express enzymatic activities per unit protein

    • Account for differences in specific activity

    • Include internal standards or reference proteins

  • Experimental design for statistical rigor:

    • Use paired experimental designs when possible

    • Include technical and biological replicates

    • Analyze data using appropriate statistical methods (ANOVA, t-tests)

    • Account for batch effects in multi-day experiments

  • Sequence verification:

    • Confirm the exact sequence of each recombinant protein

    • Pay special attention to species-specific amino acid differences (e.g., position 93)

How can MT-CO2 be utilized in allotopic expression studies?

Allotopic expression involves relocating mitochondrially-encoded genes to the nucleus. Research with Cox2 (the yeast homolog of MT-CO2) has provided insights into this process, which can be applied to Tamias MT-CO2:

  • Strategic modifications for nuclear expression:

    • Addition of a mitochondrial targeting sequence (MTS) is required

    • Inclusion of the natural 15-residue leader peptide facilitates proper import

    • Decreasing the hydrophobicity of the first transmembrane segment (TMS1) through amino acid substitutions (e.g., W56R) can facilitate import through the TIM23 translocase

    • Codon optimization for cytosolic translation machinery is necessary

  • Functional complementation approaches:

    • Using Cox2-deficient yeast strains (Δcox2) as a model system

    • Evaluating respiratory growth on non-fermentable carbon sources as a functional readout

    • Monitoring cytochrome c oxidase assembly and activity

  • Co-expression with facilitating factors:

    • TYE7 (a transcriptional factor)

    • RAS2 (a GTP-binding protein)

    • COX12 (a non-core subunit of cytochrome c oxidase)

    These factors have been shown to enhance the import and assembly of allotopically expressed Cox2 .

  • Quantitative measurements:

    • RT-qPCR to confirm expression levels

    • Immunoblotting to detect precursor and mature forms of the protein

    • Respiratory growth assays on non-fermentable carbon sources (e.g., lactate)

  • Validation of mitochondrial localization:

    • Immunofluorescence microscopy

    • Subcellular fractionation followed by Western blotting

    • Protease protection assays to confirm membrane topology

What techniques are employed for studying the evolutionary significance of MT-CO2 across chipmunk species?

The MT-CO2 gene serves as an important marker for evolutionary studies due to its mitochondrial origin and essential function. Several approaches can be utilized:

  • Phylogenetic analysis:

    • Maximum likelihood or Bayesian inference methods to construct phylogenetic trees

    • Calculation of dN/dS ratios to identify sites under selection

    • Dating of divergence times between species using molecular clock approaches

  • Population genetics approaches:

    • Analysis of haplotype diversity within and between populations

    • Identification of population structure and gene flow patterns

    • Detection of recent selective sweeps or bottlenecks

  • Comparative biochemistry:

    • Enzyme kinetics (Km, Vmax, catalytic efficiency) of recombinant proteins

    • Thermal stability profiles to assess adaptation to different environments

    • pH optima and dependence curves

  • Protein structure analysis:

    • Homology modeling based on known structures of cytochrome c oxidase

    • Molecular dynamics simulations to identify functionally important residues

    • Analysis of coevolving amino acid positions within the protein

  • Expression pattern comparisons:

    • qPCR analysis of MT-CO2 expression in different tissues

    • Comparison of expression levels between different species or populations

    • Correlation of expression patterns with environmental variables or metabolic rates

What are common challenges in expression and purification of recombinant MT-CO2, and how can they be addressed?

Recombinant production of MT-CO2 presents several challenges due to its hydrophobic nature and complex structure:

  • Inclusion body formation:

    • Challenge: Overexpression often leads to insoluble inclusion bodies

    • Solution: Lower induction temperature (16-20°C), reduce IPTG concentration (0.1-0.5 mM), co-express with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Poor solubility:

    • Challenge: Membrane proteins are inherently difficult to maintain in solution

    • Solution: Screen multiple detergents (DDM, LDAO, Triton X-100) at various concentrations; consider using detergent mixtures or amphipols for stabilization

  • Protein aggregation:

    • Challenge: MT-CO2 may aggregate during or after purification

    • Solution: Include glycerol (10-20%) in all buffers, add mild reducing agents (1-2 mM DTT or β-mercaptoethanol), optimize protein concentration (<1 mg/mL)

  • Loss of activity:

    • Challenge: Recombinant MT-CO2 may lose activity during purification

    • Solution: Minimize purification steps, maintain cold temperature throughout, include stabilizing additives (trehalose at 6% is used in commercial preparations)

  • Storage instability:

    • Challenge: Repeated freeze-thaw cycles lead to activity loss

    • Solution: Store as lyophilized powder, reconstitute with 50% glycerol, prepare single-use aliquots, avoid repeated freeze-thaw cycles as recommended in product specifications

How can researchers verify the functional integrity of recombinant MT-CO2?

Verifying the functional integrity of recombinant MT-CO2 is crucial for experimental reliability:

  • Structural analysis:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Thermal shift assays to assess stability

    • Size exclusion chromatography to detect aggregation states

  • Activity assays:

    • Spectrophotometric assays monitoring cytochrome c oxidation

    • Oxygen consumption measurements

    • H2O2 generation assays using Amplex Red/HRP system

  • Binding assays:

    • Surface plasmon resonance to measure interactions with other subunits

    • Co-immunoprecipitation with interaction partners

    • Blue native PAGE to assess complex formation

  • Reconstitution into liposomes or nanodiscs:

    • Incorporation into artificial membrane systems

    • Measurement of proton pumping activity

    • Assessment of orientation in the membrane

  • Comparison with native enzyme:

    • Parallel analysis with mitochondrially isolated enzyme

    • Evaluation of kinetic parameters

    • Examination of inhibitor sensitivity profiles

What approaches are recommended for analyzing comparative data from multiple Tamias MT-CO2 variants?

When analyzing data from experiments involving multiple MT-CO2 variants, several statistical and bioinformatic approaches are recommended:

  • Sequence analysis tools:

    • Multiple sequence alignment (MUSCLE, CLUSTAL, T-Coffee)

    • Calculation of sequence identity and similarity matrices

    • Identification of conserved domains and motifs

  • Statistical analysis for enzymatic data:

    • ANOVA followed by post-hoc tests for multiple comparisons

    • Non-parametric tests if normality assumptions are violated

    • Linear mixed-effects models to account for batch effects

    • Calculation of effect sizes and confidence intervals

  • Structure-function relationships:

    • Correlation of sequence variations with functional differences

    • Mapping variants onto structural models

    • Molecular dynamics simulations to predict effects of mutations

  • Visualization techniques:

    • Principal component analysis (PCA) to identify patterns

    • Heatmaps for comparing multiple parameters across variants

    • Network analysis for protein interaction studies

  • Evolutionary analysis:

    • Calculation of dN/dS ratios

    • Tests for selection (McDonald-Kreitman test, PAML)

    • Bayesian phylogenetic inference

    • Ancestral sequence reconstruction

How can researchers effectively integrate MT-CO2 data with broader mitochondrial function studies?

MT-CO2 research can be integrated into broader mitochondrial studies through several approaches:

What emerging technologies are expected to advance MT-CO2 research?

Several cutting-edge technologies are poised to transform research on MT-CO2 and other mitochondrial proteins:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural determination of MT-CO2 in its native complex

    • Visualization of dynamic states and conformational changes

    • Insights into assembly mechanisms and protein-protein interactions

  • CRISPR/Cas9 genome editing:

    • Generation of precise mutations in mitochondrial genes

    • Development of cellular models with specific MT-CO2 variants

    • Creation of transgenic animal models for in vivo studies

  • Single-molecule techniques:

    • Real-time observation of MT-CO2 function at the single-molecule level

    • FRET-based approaches to monitor conformational changes

    • Optical tweezers to study mechanical properties

  • Microfluidic and organ-on-chip technologies:

    • High-throughput screening of MT-CO2 variants

    • Miniaturized assay systems for reduced sample consumption

    • Integration of multiple assays on a single platform

  • Synthetic biology approaches:

    • Designer mitochondrial genomes with optimized MT-CO2 genes

    • Orthogonal translation systems for improved allotopic expression

    • Engineering of novel functions into MT-CO2

What are the potential applications of MT-CO2 research beyond evolutionary studies?

Research on Tamias MT-CO2 has implications beyond evolutionary biology:

  • Biomedical applications:

    • Insights into human mitochondrial disorders involving COX2 mutations

    • Development of gene therapy approaches for mitochondrial diseases

    • Screening platforms for mitochondrial-targeted therapeutics

  • Biotechnological applications:

    • Engineering of more efficient respiratory complexes

    • Development of biocatalysts for oxygen reduction reactions

    • Creation of biosensors for oxygen and electron transport

  • Environmental and conservation biology:

    • Biomarkers for monitoring environmental stress in wildlife

    • Assessment of adaptive capacity in the face of climate change

    • Indicators for population health and genetic diversity

  • Synthetic biology:

    • Design of artificial electron transport chains

    • Creation of minimal mitochondria with redesigned respiratory complexes

    • Development of biomimetic energy conversion systems

  • Agricultural applications:

    • Understanding of metabolic efficiency in agriculturally important species

    • Development of markers for selection of livestock with optimal mitochondrial function

    • Strategies to enhance stress resistance in crop plants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.