Recombinant Tamias rufus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tamias rufus (Hopi chipmunk)
Target Names
Target Protein Sequence
MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLNPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. MT-CO2 plays a crucial role in the final step of this process, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c are transferred through the copper A center (CuA) and heme A to the binuclear center (BNC), composed of heme a3 and copper B (CuB). The BNC then uses these electrons, along with protons from the matrix, to reduce oxygen to water.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does Tamias rufus MT-CO2 differ structurally from that of other Tamias species and closely related genera?

While specific structural data for T. rufus MT-CO2 requires further research, comparative analyses of MT-CO2 across related species can provide insight into potential differences. Studies of cytochrome c oxidase subunit II in primates have shown that functionally important amino acids are generally conserved across species, with variations primarily occurring in less critical regions . In Tamias species, we would expect the catalytic core and functional domains to remain highly conserved, with most interspecies variations occurring in the amino terminal end of the protein. These variations likely reflect adaptations to specific ecological niches and metabolic requirements of different chipmunk species. Phylogenetic analyses using MT-CO2 sequences have proven valuable for determining evolutionary relationships among other mammalian groups, suggesting that sequence analysis of T. rufus MT-CO2 could help clarify taxonomic relationships within the Tamias genus .

What expression systems are most suitable for producing recombinant Tamias rufus MT-CO2?

Several expression systems can be employed for recombinant T. rufus MT-CO2 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsYield Potential
Bacterial (E. coli)Rapid growth, high yields, low costLack of post-translational modifications, potential for inclusion bodies10-100 mg/L
Yeast (P. pastoris)Eukaryotic processing, higher folding accuracyLonger production time, more complex media5-50 mg/L
Mammalian cell linesNative-like folding and modificationsHigh cost, low yields, complex maintenance1-10 mg/L
Photoautotrophic systems (Synechococcus)Light energy utilization, CO₂ consumption, stress-responsive promotersSpecialized equipment, lower yield than E. coli2-20 mg/L

Recent research has demonstrated significant success with cyanobacterial systems like Synechococcus elongatus PCC 7942 for recombinant protein production. These systems can harness light energy and utilize CO₂, potentially making them cost-effective and environmentally sustainable options . The integration of native promoters like psbA2, which responds to stress conditions, has shown promising results for enhanced recombinant protein expression in these systems .

What are the common challenges in achieving proper folding of recombinant MT-CO2 protein?

Proper folding of recombinant MT-CO2 presents several challenges due to its complex membrane-associated structure. The protein contains multiple transmembrane domains that must be correctly oriented during synthesis. Major folding challenges include:

  • Hydrophobic regions: The transmembrane segments of MT-CO2 are highly hydrophobic and prone to aggregation during recombinant expression, particularly in aqueous environments.

  • Cofactor incorporation: Native MT-CO2 contains metal cofactors essential for electron transfer, which may not be properly incorporated during recombinant expression.

  • Mitochondrial targeting: In native contexts, MT-CO2 is expressed within mitochondria, and recombinant systems lack this specialized environment.

  • Intersubunit interactions: MT-CO2 functions as part of a larger complex, and isolated expression may result in improper folding without its interaction partners.

To address these challenges, researchers have implemented strategies such as fusion tags to increase solubility, specialized detergents for membrane protein extraction, and co-expression of chaperone proteins to facilitate folding . The use of stress-responsive promoters, as demonstrated in Synechococcus systems, can also enhance proper folding by mimicking native expression conditions .

How can MT-CO2 sequence data from Tamias rufus be used in phylogenetic studies?

MT-CO2 sequence data has proven valuable for phylogenetic studies across various mammalian taxa. For Tamias rufus, MT-CO2 can provide insights into evolutionary relationships within the Sciuridae family and specifically within the Tamias genus. Research on primate MT-CO2 has demonstrated this gene's utility in resolving phylogenetic relationships, including sister-group relationships between taxa . For Tamias species, MT-CO2 sequence analysis can help:

  • Resolve species boundaries within the genus

  • Identify potential hybridization events between closely related species

  • Determine divergence times between lineages

  • Understand evolutionary rate variation across the genus

The evidence from primate studies suggests that higher primates have undergone a nearly two-fold increase in the rate of amino acid replacement in MT-CO2 relative to other primates . Similar analyses in Tamias could reveal whether certain lineages have experienced accelerated evolution, potentially correlating with ecological adaptations or speciation events. When combined with nuclear genetic markers, MT-CO2 data can contribute to robust phylogenetic reconstructions that help clarify the evolutionary history of Tamias rufus and its relatives.

What specific molecular adaptations in Tamias rufus MT-CO2 might reflect environmental adaptations compared to high-altitude dwelling Tamias species?

The MT-CO2 gene potentially contains signatures of adaptive evolution in response to different environmental pressures across Tamias species. For species inhabiting high-altitude environments, molecular adaptations in MT-CO2 might enhance oxygen binding efficiency and electron transport under hypoxic conditions. Comparative studies of MT-CO2 sequences between T. rufus and high-altitude Tamias species might reveal selection on specific amino acid residues that influence protein-protein interactions or catalytic efficiency. Studies in primates have shown that while functionally important amino acids remain conserved across species, variations in the amino terminal end of the protein may have functional significance . In Tamias species adapted to different altitudes, we might expect to see amino acid substitutions in regions that interact with cytochrome c or influence proton pumping efficiency. These adaptations could potentially explain differences in metabolic efficiency and cold tolerance observed among Tamias species from varying elevations.

How do post-translational modifications of recombinant MT-CO2 compare between different expression systems, and what impacts do these have on protein function?

Post-translational modifications (PTMs) of recombinant MT-CO2 vary significantly between expression systems and can dramatically affect protein function:

Expression SystemCommon PTMsFunctional ImpactSimilarity to Native Protein
Bacterial (E. coli)Minimal to nonePotential loss of regulation, altered stabilityLow
Yeast (P. pastoris)Phosphorylation, limited glycosylationImproved stability, partial regulatory capacityModerate
Mammalian cell linesPhosphorylation, acetylation, complex glycosylationNative-like regulation and stabilityHigh
Insect cellsPhosphorylation, simple glycosylationIntermediate regulation, good stabilityModerate-High
Photoautotrophic systemsSystem-specific, light-responsive modificationsVariable based on light conditionsVariable

Research suggests that native MT-CO2 undergoes several PTMs that regulate its activity and stability, including phosphorylation and acetylation. The choice of expression system significantly impacts which PTMs occur on recombinant MT-CO2. Bacterial systems like E. coli typically lack the cellular machinery for mammalian-type PTMs, potentially resulting in functionally compromised protein . Photoautotrophic systems like Synechococcus may introduce unique light-responsive modifications that could affect protein function in experimental contexts . When selecting an expression system, researchers should consider the specific PTMs required for their experimental purposes and choose accordingly.

What are the implications of amino acid replacements at positions 114-115 in Tamias rufus MT-CO2 for enzyme kinetics and interspecies compatibility?

The replacement of carboxyl-bearing residues (glutamate and aspartate) at positions 114 and 115 in MT-CO2 has significant implications for enzyme kinetics and interspecies compatibility. Studies in primates have shown that changes at these positions may explain the poor enzyme kinetics observed in cross-reactions between cytochromes c and cytochrome c oxidases of higher primates and other mammals . In Tamias rufus, similar replacements could influence:

These amino acid positions appear to be critical for proper interaction between cytochrome c and cytochrome c oxidase. The specific residues at these positions in T. rufus MT-CO2 could provide insights into the evolution of species-specific interactions within the electron transport chain. Experimental studies comparing enzyme kinetics with cytochrome c from various species would help quantify the functional consequences of these amino acid replacements and potentially reveal patterns of co-evolution between interacting proteins in the respiratory chain .

How can stress-responsive promoters be optimized for enhanced expression of recombinant Tamias rufus MT-CO2 in cyanobacterial systems?

Optimization of stress-responsive promoters for MT-CO2 expression in cyanobacterial systems involves several key strategies:

  • Promoter selection: The psbA2 promoter has shown promise for recombinant protein production in Synechococcus elongatus PCC 7942 due to its response to stress conditions . For T. rufus MT-CO2 expression, this promoter could be further optimized by:

    • Creating synthetic variants with enhanced transcription factor binding sites

    • Integrating additional stress-responsive elements to create combinatorial promoters

    • Engineering the -10 and -35 regions for optimal RNA polymerase binding

  • Stress condition optimization: Research has demonstrated that exposure to magnetic fields (MF) can significantly enhance recombinant protein expression under the psbA2 promoter in Synechococcus . Optimal conditions include:

    • 30 mT magnetic field strength (MF30), which showed significant increases in transcription

    • Pulsed magnetic field application to minimize adaptation responses

    • Combined light/dark cycling with magnetic field exposure

  • Codon optimization: Adapting the T. rufus MT-CO2 coding sequence to cyanobacterial codon usage preferences can significantly improve translation efficiency without altering the amino acid sequence.

  • Ribosome binding site engineering: Optimizing the ribosome binding site strength and spacing can enhance translation initiation.

These approaches leverage the stress-responsive nature of the psbA2 promoter while avoiding the need for costly exogenous inducers that could potentially stress the cells . The magnetic field approach is particularly promising as it positively impacts photosystem II without disrupting the electron transport chain, aligning with the "quantum-mechanical mechanism" theory of magnetic field effects on biological systems .

What insights can comparative analysis of MT-CO2 provide about the molecular evolution of the electron transport chain in sciurid rodents?

Comparative analysis of MT-CO2 across sciurid rodents can reveal important insights about the molecular evolution of the electron transport chain in this group. Studies in primates have demonstrated that MT-CO2 evolution can provide evidence for varying rates of molecular evolution and adaptation . For sciurid rodents, including Tamias species, MT-CO2 analysis could reveal:

  • Evolutionary rate variations: Different lineages of sciurids may show accelerated or decelerated rates of MT-CO2 evolution, potentially correlating with ecological adaptations or speciation events. In primates, a nearly two-fold increase in amino acid replacement rates was observed in monkeys and apes compared to other primates .

  • Selection signatures: Positive selection on specific amino acid sites could indicate adaptation to different environmental conditions, metabolic requirements, or interacting proteins.

  • Co-evolutionary patterns: MT-CO2 evolution likely occurs in concert with other components of the electron transport chain, particularly cytochrome c with which it directly interacts. Examining co-evolutionary patterns could reveal constraints on protein-protein interactions within the respiratory complex.

  • Hybridization effects: In zones where different Tamias species hybridize, analysis of MT-CO2 could reveal patterns of introgression and potential functional consequences of mixing divergent mitochondrial and nuclear genomes.

By integrating MT-CO2 sequence data with ecological, physiological, and biogeographic information, researchers can gain a more comprehensive understanding of how selection has shaped the evolution of cellular respiration in sciurid rodents across diverse environments and evolutionary timescales.

What are the optimal PCR conditions for amplifying Tamias rufus MT-CO2 from tissue samples?

Successful amplification of MT-CO2 from Tamias rufus tissue samples requires carefully optimized PCR conditions:

ParameterRecommended ConditionNotes
DNA extraction methodPhenol-chloroform or commercial kit with specific mitochondrial enrichmentEnsures high-quality mtDNA template
Primer designForward: 5'-ATGGCACATGCAGCGCAAGT-3' (based on conserved regions)Derived from comparison with known rodent sequences
Reverse: 5'-GGCATGAAGTGGCAGCTTCT-3'
PCR bufferStandard Taq buffer with 2.0 mM MgCl₂Magnesium concentration critical for specificity
dNTP concentration200 μM eachHigher concentrations may reduce specificity
Template amount10-50 ng total DNAExcessive template can inhibit reaction
Annealing temperatureInitial 58°C, optimize as neededGradient PCR recommended for optimization
Extension time1 minute at 72°CMT-CO2 is approximately 700 bp
Cycle number30-35 cyclesAvoid excessive cycles to prevent artifacts
Hot startRecommendedReduces non-specific amplification

For samples of varying quality or age, nested PCR may be necessary. The initial amplification would use external primers targeting conserved regions flanking MT-CO2, followed by a second PCR using the product as template with internal primers specific to MT-CO2. For phylogenetic studies or when working with degraded samples, designing multiple overlapping primer pairs can ensure complete coverage of the gene . Adding BSA (0.1-0.8 μg/μL) to the reaction mix can help overcome PCR inhibitors commonly found in tissue samples.

What purification strategies yield the highest purity recombinant MT-CO2 suitable for functional studies?

Purifying recombinant MT-CO2 to high purity while maintaining functional integrity requires a multi-step approach:

  • Initial capture:

    • For His-tagged constructs: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co²⁺ resin

    • For GST-tagged constructs: Glutathione affinity chromatography

    • Buffer composition is critical: typically 50 mM Tris-HCl pH 8.0, 150 mM NaCl, with 0.1-1% appropriate detergent (DDM, LDAO, or C₁₂E₈)

  • Secondary purification:

    • Ion exchange chromatography: usually anion exchange (MT-CO2 pI ≈ 5.5)

    • Size exclusion chromatography: separates monomeric from aggregated protein

    • Buffer optimization: detergent concentration should be maintained above CMC

  • Advanced purification for functional studies:

    • Lipid nanodisc incorporation: provides native-like membrane environment

    • Affinity tag removal: using site-specific proteases (TEV, PreScission)

    • Final polishing step: reverse-phase HPLC for highest purity

The purification of membrane proteins like MT-CO2 is particularly challenging due to their hydrophobic nature . Throughout purification, it's essential to maintain an appropriate detergent concentration to prevent aggregation while not interfering with downstream applications. The choice of detergent is critical, with milder detergents like DDM often preferred for functional studies despite slightly lower yields.

Using photoautotrophic systems like Synechococcus for expression may require specialized purification approaches, particularly when integrating native promoters like psbA2 . The use of magnetic field stimulation during expression can impact protein folding and potentially influence purification requirements .

How can researchers effectively design and validate site-directed mutagenesis experiments for studying MT-CO2 function?

Effective design and validation of site-directed mutagenesis experiments for MT-CO2 functional studies requires systematic approach:

  • Target selection:

    • Focus on evolutionarily conserved residues identified through multiple sequence alignment

    • Prioritize residues at positions 114-115, which are critical for interaction with cytochrome c

    • Consider residues in predicted transmembrane domains or metal-binding sites

    • Include control mutations at non-conserved sites

  • Mutation design strategy:

    • Conservative mutations: substitute with physicochemically similar amino acids

    • Non-conservative mutations: change the fundamental properties (charge, hydrophobicity)

    • Alanine scanning: systematic replacement with alanine to identify essential residues

    • Domain swapping: replace segments with corresponding regions from other species

  • Validation hierarchy:

Validation LevelTechniquesInsights Gained
Sequence verificationSanger sequencing, NGSConfirmation of intended mutation
Expression validationWestern blot, mass spectrometryVerification of full-length protein
Structural integrityCircular dichroism, thermal shift assaysConfirmation of proper folding
Subcellular localizationImmunofluorescence, subcellular fractionationVerification of correct targeting
Protein-protein interactionsCo-immunoprecipitation, FRET/BRETAssessment of binding to cytochrome c
Functional activityOxygen consumption, electron transfer ratesQuantification of catalytic activity
  • Controls and comparisons:

    • Wild-type protein as positive control

    • Known inactive mutant as negative control

    • Taxonomically diverse MT-CO2 variants for evolutionary context

Cross-species studies are particularly valuable, as differences in positions 114-115 have been implicated in species-specific interactions between cytochrome c and cytochrome c oxidase . Comparing T. rufus MT-CO2 function with that of related species can provide insights into adaptive evolution of the electron transport chain in different ecological contexts.

What approaches can be used to accurately measure the functional activity of recombinant MT-CO2 in vitro?

Accurate measurement of recombinant MT-CO2 functional activity requires specialized techniques that assess both isolated protein function and integration into the electron transport chain:

  • Polarographic oxygen consumption assays:

    • Clark-type electrode measurements in reconstituted proteoliposomes

    • Oxygen consumption rates in response to electron donors (reduced cytochrome c)

    • Inhibitor sensitivity testing (azide, cyanide) to confirm specificity

    • Temperature and pH dependence profiles to assess environmental adaptations

  • Electron transfer kinetics:

    • Stopped-flow spectroscopy to measure electron transfer rates

    • Flash photolysis for time-resolved measurements

    • Calculation of Michaelis-Menten parameters (K<sub>m</sub>, V<sub>max</sub>, k<sub>cat</sub>)

    • Cross-species cytochrome c compatibility tests

  • Proton pumping efficiency:

    • pH-sensitive fluorescent dyes in proteoliposomes

    • Membrane potential measurements using voltage-sensitive probes

    • H⁺/e⁻ stoichiometry determination

  • Spectroscopic analyses:

    • Absorption spectroscopy to monitor redox state changes

    • Resonance Raman spectroscopy for metal center characterization

    • EPR spectroscopy to examine paramagnetic species

Functional comparisons between T. rufus MT-CO2 and that of other species can reveal adaptations related to environmental conditions or evolutionary history. Particular attention should be paid to potential differences in cross-reactivity with cytochrome c from different species, as positions 114-115 in MT-CO2 have been implicated in species-specific interactions . These measurements can help determine whether amino acid replacements in T. rufus MT-CO2 affect enzyme kinetics in ways that might reflect ecological adaptations.

How can researchers overcome challenges in expressing membrane proteins like MT-CO2 in recombinant systems?

Expressing membrane proteins like MT-CO2 in recombinant systems presents unique challenges that require specialized strategies:

  • Toxicity management:

    • Use tightly regulated inducible promoters to prevent leaky expression

    • Employ specialized host strains designed for toxic protein expression

    • Consider lower-temperature expression to slow production and allow proper folding

    • Implement stress-responsive promoters like psbA2 that activate under controlled conditions

  • Solubility enhancement:

    • Fusion with solubility-enhancing tags (MBP, SUMO, thioredoxin)

    • Co-expression with specific chaperones (Hsp70, Hsp90, GroEL/ES)

    • Addition of chemical chaperones to growth media (glycerol, arginine)

    • Expression as truncated functional domains when appropriate

  • Membrane integration support:

    • Use of specialized detergents during extraction and purification

    • Cell-free expression systems with supplied lipids or nanodiscs

    • Co-expression of relevant assembly factors from the source organism

    • Directed evolution approaches to select for variants with improved expression

  • Expression system optimization:

SystemOptimization StrategyBenefit
E. coliC41(DE3)/C43(DE3) strainsSpecifically evolved for membrane protein expression
LEMO21(DE3) for tunable expressionFine control over expression levels
YeastInducible GAL1 promoterControlled expression timing
Specialized secretion signalsProper membrane targeting
Insect cellsLate promoters (polh, p10)High-level expression with proper folding
Extension of expression timeAllows for slower, more complete folding
PhotoautotrophicLight intensity modulationControl of photosynthetic activity and energy availability
Application of magnetic fields (30 mT)Enhanced transcription under stress-responsive promoters
  • Codon optimization and sequence modifications:

    • Adapt codon usage to expression host preferences

    • Remove potential cryptic splice sites, internal ribosome binding sites

    • Optimize GC content and mRNA secondary structures

    • Consider synonymous mutations to reduce translation rate at critical folding regions

Recent research with Synechococcus elongatus PCC 7942 has demonstrated that integration of native promoters combined with magnetic field application (30 mT) can significantly enhance recombinant protein expression . This approach is particularly promising for membrane proteins as it leverages natural stress responses without introducing potentially damaging chemical inducers .

What statistical approaches are most appropriate for analyzing evolutionary rates of MT-CO2 across Tamias species?

Analyzing evolutionary rates of MT-CO2 across Tamias species requires robust statistical approaches to account for phylogenetic relationships and varying selective pressures:

  • Phylogenetic comparative methods:

    • Phylogenetically Independent Contrasts (PIC) to control for shared ancestry

    • Phylogenetic Generalized Least Squares (PGLS) for continuous trait correlation

    • Ornstein-Uhlenbeck models to test for selection toward optimal values

    • Brownian Motion models as null hypotheses for neutral evolution

  • Selection analysis:

    • Site-specific models (PAML, HYPHY) to identify positively selected codons

    • Branch-site tests to detect episodic selection on specific lineages

    • McDonald-Kreitman test to compare polymorphism versus divergence

    • Relative rates tests to identify lineages with accelerated evolution

  • Robust statistical frameworks:

    • Bayesian approaches with appropriate prior distributions

    • Maximum likelihood methods with model selection criteria (AIC, BIC)

    • Bootstrap resampling for confidence interval estimation

    • Permutation tests for hypothesis testing

  • Integrated analytical approaches:

Analysis TypeSoftware/MethodApplication to MT-CO2
Sequence conservationConSurf, Rate4SiteIdentify functionally critical residues
Coevolutionary analysisCAPS, DCA, SCADetect coordinated evolution with cytochrome c
Molecular datingBEAST, MCMCTreeEstimate divergence times of MT-CO2 variants
Ancestral sequence reconstructionFastML, PAMLInfer historical sequences at key nodes

Studies in primates have revealed that higher primates experienced a nearly two-fold increase in the rate of amino acid replacement in MT-CO2 compared to other primate lineages . Similar analyses in Tamias species could reveal whether certain lineages have undergone accelerated evolution, potentially correlating with ecological adaptations, speciation events, or hybridization. Particular attention should be paid to the amino terminal end of the protein, which shows increased variation in primates, and positions 114-115, which may influence interaction with cytochrome c .

How can researchers identify and interpret signatures of positive selection in Tamias rufus MT-CO2?

Identifying and interpreting signatures of positive selection in T. rufus MT-CO2 requires multi-layered analytical approaches:

  • Sequence-based detection methods:

    • Nonsynonymous to synonymous substitution rate ratios (dN/dS or ω)

    • Site-specific models (M1a vs M2a, M7 vs M8 in PAML)

    • Branch-site models to detect selection on specific Tamias lineages

    • MEME analysis for episodic selection

    • FUBAR for site-specific selection with Bayesian approach

  • Structural mapping of selected sites:

    • 3D homology modeling of T. rufus MT-CO2 based on crystallographic data

    • Mapping selected sites onto structural model

    • Analysis of proximity to functional domains:

      • Cytochrome c binding interface

      • Proton channels

      • Metal binding sites

      • Transmembrane regions

  • Functional context interpretation:

Selection PatternPotential Biological InterpretationValidation Approach
Selection at positions 114-115Adaptation for species-specific cytochrome c interactionIn vitro binding assays with cytochrome c from different species
Selection in transmembrane domainsAdaptation to different membrane environmentsLipid composition analysis, membrane fluidity measurements
Selection in N-terminal regionAltered regulatory interactionsProtein-protein interaction assays
Selection in metal-binding regionsModified catalytic propertiesEnzyme kinetics comparing wild-type and mutant proteins
  • Ecological correlation:

    • Association of selected sites with environmental variables (altitude, temperature, habitat)

    • Comparison across Tamias species with different ecological niches

    • Analysis of parallel evolution in unrelated species under similar ecological pressures

Studies in primates have demonstrated that while functionally important amino acids are generally conserved, specific regions like the amino terminal end show increased variation that may have functional significance . The replacement of carboxyl-bearing residues at positions 114-115 appears particularly important for interaction with cytochrome c . Similar patterns in Tamias species could provide insights into adaptive evolution of the electron transport chain in response to different ecological pressures across the genus.

What computational approaches can predict the impact of amino acid substitutions on MT-CO2 structure and function?

Computational prediction of amino acid substitution impacts on MT-CO2 structure and function requires integrated bioinformatic approaches:

  • Sequence-based prediction tools:

    • SIFT: Predicts whether substitutions affect protein function based on sequence homology

    • PolyPhen-2: Combines sequence conservation with structural features

    • PROVEAN: Evaluates the impact of amino acid variations on protein function

    • MutPred: Predicts molecular mechanisms underlying disease-associated substitutions

    • SNAP2: Neural network-based classifier for substitution effects

  • Structure-based prediction methods:

    • FoldX: Calculates changes in protein stability upon mutation

    • PyRosetta: Allows detailed modeling of mutant structures

    • CUPSAT: Analyzes protein stability changes upon point mutations

    • SDM: Predicts stability changes based on environment-specific substitution tables

    • mCSM: Uses graph-based signatures to predict stability changes

  • Molecular dynamics simulations:

    • GROMACS, NAMD, or AMBER for all-atom simulations

    • Coarse-grained models for larger-scale conformational changes

    • Analysis of:

      • Protein flexibility changes

      • Hydrogen bonding network alterations

      • Water accessibility modifications

      • Electrostatic surface property changes

  • Integration of multiple approaches:

Computational ApproachSpecific Application to MT-CO2Expected Insights
Homology modelingBuild 3D model of T. rufus MT-CO2Structural context for mutations
Electrostatic calculationsAnalyze surface charge distributionImpact on cytochrome c binding
Molecular dockingModel MT-CO2/cytochrome c interactionPredict binding affinity changes
Network analysisIdentify allosteric communication pathsLong-range effects of mutations
Evolutionary coupling analysisDetect co-evolving residue pairsFunctional dependencies between sites

For MT-CO2, particular attention should be paid to substitutions at positions 114-115, which have been implicated in species-specific interactions with cytochrome c in primates . Computational predictions can guide experimental studies by identifying potentially impactful substitutions for site-directed mutagenesis and functional characterization. When analyzing Tamias rufus MT-CO2, comparing predictions across related species can provide context for understanding lineage-specific adaptations and their functional consequences.

What are the best practices for designing and analyzing enzyme kinetics experiments with recombinant MT-CO2?

Designing and analyzing enzyme kinetics experiments with recombinant MT-CO2 requires careful consideration of multiple factors:

  • Experimental design considerations:

    • Substrate concentration ranges spanning at least 0.2× to 5× K<sub>m</sub>

    • Multiple technical and biological replicates (minimum n=3)

    • Appropriate controls:

      • No-enzyme controls

      • Heat-inactivated enzyme

      • Known inhibitors (azide, cyanide)

      • Wild-type protein as reference

  • Assay optimization:

    • Buffer composition optimization:

      • pH range testing (typically pH 6.0-8.0)

      • Ionic strength variation

      • Metal ion requirements

    • Temperature optimization relevant to Tamias rufus physiology

    • Detergent type and concentration for membrane protein stability

    • Proteoliposome composition to mimic native membrane environment

  • Kinetic model selection and application:

Kinetic ModelApplication ScenarioParameters Obtained
Michaelis-MentenSimple hyperbolic kineticsK<sub>m</sub>, V<sub>max</sub>, k<sub>cat</sub>, k<sub>cat</sub>/K<sub>m</sub>
Substrate inhibitionActivity decreases at high substrateK<sub>m</sub>, V<sub>max</sub>, K<sub>i</sub>
Hill equationCooperative bindingK<sub>0.5</sub>, V<sub>max</sub>, Hill coefficient (n)
Bi-substrate modelsFor analyzing electron donor and acceptorK<sub>m1</sub>, K<sub>m2</sub>, V<sub>max</sub>, order of binding
  • Data analysis best practices:

    • Non-linear regression rather than linearization methods

    • Weighted regression when variance is heteroscedastic

    • Global fitting for complex models

    • Bootstrap or jackknife resampling for parameter confidence intervals

    • Residual analysis to validate model fit

    • Akaike Information Criterion (AIC) for model selection

  • Comparative kinetic analysis:

    • Direct comparison with MT-CO2 from related Tamias species

    • Testing with cytochrome c from different species to assess compatibility

    • Analysis of temperature and pH profiles for adaptation signatures

    • Inhibitor sensitivity comparison across species

When studying T. rufus MT-CO2, attention should be paid to potential differences in cross-reactivity with cytochrome c from different species, particularly given the importance of positions 114-115 for these interactions . Comparative kinetic studies can reveal adaptations related to the specific ecological niche of T. rufus and provide insights into the evolution of the electron transport chain in sciurid rodents.

How can researchers integrate structural, functional, and evolutionary data for comprehensive understanding of Tamias rufus MT-CO2?

Integrating structural, functional, and evolutionary data provides a comprehensive understanding of T. rufus MT-CO2 through multiple complementary approaches:

  • Data integration frameworks:

    • Structure-function mapping: correlating sequence variations with biochemical properties

    • Phylogenetic comparative methods: contextualizing functional differences within evolutionary history

    • Ecological correlation analysis: linking molecular adaptations to environmental factors

    • Network approaches: examining MT-CO2 within the broader context of mitochondrial function

  • Multi-omics integration:

    • Genomics: MT-CO2 sequence variation across populations and related species

    • Transcriptomics: expression patterns in different tissues and conditions

    • Proteomics: post-translational modifications and protein-protein interactions

    • Metabolomics: downstream effects on cellular respiration and energy metabolism

  • Visualization and analytical tools:

Integration ApproachSpecific Tools/MethodsApplication to MT-CO2 Research
Structural visualizationPyMOL, UCSF ChimeraMapping conservation, selection, and functional sites on 3D models
Evolutionary tracingET Viewer, ConSurfIdentifying functionally important residues through evolutionary conservation
Ancestral state reconstructionPAML, FastMLInferring historical sequence changes and selection events
Molecular dynamicsGROMACS, NAMDSimulating conformational dynamics under different conditions
Machine learning approachesRandom forests, neural networksPredicting functional impact of sequence variations
  • Hierarchical integration strategy:

    • Molecule level: Protein structure, dynamics, and interactions

    • Organelle level: Mitochondrial function and efficiency

    • Cell level: Energy metabolism and cellular respiration

    • Organism level: Physiological adaptations and fitness

    • Population level: Genetic variation and natural selection

    • Species level: Phylogenetic relationships and speciation

    • Ecosystem level: Ecological adaptations and niche specialization

Studies in primates have demonstrated that MT-CO2 contains signatures of evolutionary adaptation, including accelerated evolution in certain lineages and functional changes affecting interaction with cytochrome c . For T. rufus, integrating data across these multiple levels can reveal how molecular adaptations in MT-CO2 contribute to the species' unique ecological adaptations and evolutionary history within the Tamias genus. Particular attention should be paid to regions showing evidence of selection, especially positions 114-115 which may influence species-specific protein interactions in the electron transport chain .

What are the most promising applications of recombinant Tamias rufus MT-CO2 in comparative biochemistry and evolutionary studies?

Recombinant T. rufus MT-CO2 offers numerous promising applications for advancing our understanding of comparative biochemistry and evolutionary biology:

  • Evolutionary rate calibration: T. rufus MT-CO2 can serve as a reference point for calibrating molecular clocks within Sciuridae, helping to date divergence events and correlate genetic changes with geological or ecological events. Studies in primates have shown varying rates of MT-CO2 evolution across lineages, with higher primates exhibiting nearly two-fold increased rates of amino acid replacement .

  • Structure-function relationship elucidation: Through site-directed mutagenesis and comparative studies with other species, recombinant T. rufus MT-CO2 can help identify critical residues that determine species-specific functional properties. Particular focus should be placed on the amino terminal region, which shows increased variation in primates, and positions 114-115, which influence interaction with cytochrome c .

  • Hybrid protein engineering: Creating chimeric proteins with domains from different Tamias species can help identify regions responsible for specific adaptations to different ecological niches. This approach can reveal how evolutionary changes in MT-CO2 sequence translate to functional differences in the electron transport chain.

  • Model system development: T. rufus MT-CO2 can serve as a model system for studying how membrane proteins evolve and adapt to different environmental conditions, providing insights applicable to other systems. The optimization of expression systems, particularly photoautotrophic ones like Synechococcus with stress-responsive promoters and magnetic field application, offers innovative approaches for recombinant membrane protein production .

  • Ecological adaptation biomarkers: Specific variants of MT-CO2 can potentially serve as biomarkers for adaptation to particular environmental conditions, helping to predict how species might respond to changing conditions. This application is particularly relevant in the context of climate change and habitat alteration.

These applications collectively contribute to our understanding of how fundamental cellular processes evolve and adapt across species, with implications for both basic science and applied fields such as conservation biology and biotechnology.

What future research directions could build upon current knowledge of Tamias rufus MT-CO2?

Future research on T. rufus MT-CO2 could pursue several promising directions that build upon current knowledge:

  • Population genomics: Sequencing MT-CO2 across T. rufus populations from different ecological contexts could reveal intraspecific variation and ongoing selection. This approach could identify variants associated with local adaptation to different altitudes, temperatures, or other environmental factors.

  • Hybrid zone studies: Investigating MT-CO2 in hybrid zones between T. rufus and related Tamias species could provide insights into mitochondrial-nuclear compatibility and the role of cytonuclear interactions in speciation. This research could reveal patterns similar to those observed in other hybridizing species and contribute to our understanding of speciation mechanisms.

  • Climate change response: Experimental studies examining MT-CO2 function under different temperature regimes could help predict how T. rufus might respond to climate change. This research is particularly relevant given the importance of mitochondrial function for thermal tolerance and energy metabolism.

  • Advanced protein engineering:

    • CRISPR-based approaches for precise genomic integration

    • Directed evolution to improve expression and stability

    • Computational design of optimized variants

    • Integration with artificial intelligence for prediction of functional properties

  • Methodological innovations:

Research DirectionInnovative ApproachesExpected Outcomes
Single-molecule studiesFluorescence resonance energy transfer (FRET)Real-time observation of conformational changes
Cryo-EM analysisHigh-resolution structural determinationDetailed structural insights in native-like environment
In vivo imagingGenetically encoded sensorsDynamic monitoring of MT-CO2 function in living cells
Systems biologyIntegration with metabolic flux analysisUnderstanding MT-CO2's role in broader cellular context
Environmental proteomicsField-based protein analysisDirect measurement of MT-CO2 variation in natural populations
  • Biotechnological applications: Exploring potential applications of T. rufus MT-CO2 in biosensors, bioremediation, or bioenergy production based on its specific functional properties. The optimization approaches demonstrated in systems like Synechococcus, including the use of native promoters and magnetic field application, could be adapted for these biotechnological applications .

These future directions represent promising avenues for advancing our understanding of MT-CO2 evolution, function, and potential applications, building on the foundation of current knowledge while incorporating cutting-edge techniques and approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.