Recombinant Tamias sonomae Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify this during your order to facilitate preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tamias sonomae (Sonoma chipmunk)
Target Names
Target Protein Sequence
MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLSPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. MT-CO2 plays a vital role in this process. Within complex IV, MT-CO2 contributes to the dinuclear copper A center (CuA) which facilitates electron transfer from reduced cytochrome c (in the intermembrane space) to heme A (in subunit 1) and ultimately to the binuclear center (BNC). The BNC, composed of heme a3 and copper B (CuB), catalyzes the reduction of oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its role in cellular metabolism?

MT-CO2 (mitochondrially encoded cytochrome c oxidase subunit 2) is a critical component of respiratory chain complex IV in the mitochondrial inner membrane. It contributes to cytochrome-c oxidase activity and is involved in mitochondrial electron transport from cytochrome c to oxygen . The protein plays an essential role in the final step of the electron transport chain, where it helps catalyze the reduction of oxygen to water while pumping protons across the mitochondrial membrane. This process is fundamental to cellular energy production through oxidative phosphorylation. MT-CO2 is encoded by mitochondrial DNA and synthesized within the mitochondria, unlike nuclear-encoded respiratory chain components .

How does recombinant Tamias sonomae MT-CO2 differ from native MT-CO2?

Recombinant Tamias sonomae MT-CO2 is typically produced with affinity tags (commonly His-tags) to facilitate purification. The recombinant protein is expressed in prokaryotic systems such as E. coli, which differs from its native mitochondrial synthesis environment . While the core protein sequence remains identical to the native form, the addition of the His-tag at the N-terminus alters its molecular weight and potentially its solubility characteristics. Additionally, recombinant MT-CO2 lacks the post-translational modifications that might be present in the native protein since bacterial expression systems do not perform the same modifications as eukaryotic cells. Researchers should consider these differences when designing experiments that aim to study protein-protein interactions or enzymatic activity .

How is MT-CO2 used in phylogenetic studies of chipmunk species?

MT-CO2 is widely used as a molecular marker for phylogenetic analysis of chipmunk species due to its relatively consistent mutation rate . Researchers extract mitochondrial DNA from tissue samples, amplify the MT-CO2 gene using PCR with conserved primers, and then sequence the amplified fragments. The resulting sequences are aligned and analyzed to construct phylogenetic trees that reveal evolutionary relationships among chipmunk species. A landmark study demonstrated that MT-CO2 sequences provide sufficient resolution to distinguish between closely related chipmunk taxa, including the differentiation between T. sonomae, T. cinereicollis, and other members of the genus .

The table below shows the relationship between chipmunk taxa with introgressed mitochondrial DNA and their source species, along with divergence times and maximum mitochondrial DNA percent divergence:

TaxonN# Int. (%)SourceDiv. time (Myr)Maximum mtDNA % DivRef
T. r. ruficaudus1310 (0)NA1,2
T. r. simulans17563 (36)T. r. ruficaudus0.354.71,2
T. a. canicaudus4646 (100)T. r. simulans2.753.2a2,3
T. a. luteiventris14843 (29)T. r. ruficaudus2.7510.02,3
Other T. amoenus1220 (0)NA4
T. dorsalis5435 (65)T. cinereicollis1.334.65
T. umbrinus1.784.75

This data highlights how MT-CO2 can be used to trace mitochondrial introgression events across closely related species .

What expression systems are recommended for producing recombinant Tamias sonomae MT-CO2?

E. coli is the most commonly used expression system for recombinant Tamias sonomae MT-CO2 due to its efficiency and cost-effectiveness . The protein coding sequence is typically cloned into an expression vector containing a strong promoter (such as T7) and a His-tag sequence for purification. BL21(DE3) strain is particularly suitable as it lacks certain proteases that might degrade the recombinant protein. The expression is induced using IPTG, typically at lower temperatures (16-20°C) to enhance protein solubility.

For optimal expression, codon optimization for E. coli is recommended, as the codon usage in mammalian mitochondrial genes differs significantly from that of bacteria. Inclusion of molecular chaperones (such as GroEL/GroES) as co-expression partners can improve folding and solubility. For applications requiring post-translational modifications, mammalian or insect cell expression systems may be preferable, though yields are typically lower .

What are the recommended purification protocols for His-tagged recombinant MT-CO2?

Purification of His-tagged recombinant MT-CO2 is typically performed using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin. After bacterial cell lysis (preferably using sonication in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors), the clarified lysate is applied to a Ni-NTA column. The column is washed with buffer containing 20-50 mM imidazole to remove non-specifically bound proteins, and the His-tagged MT-CO2 is eluted with 250-300 mM imidazole .

For higher purity, a second purification step using size exclusion chromatography is recommended. The protein should be dialyzed against a storage buffer (typically Tris-based buffer with 50% glycerol) and stored at -20°C or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . The expected purity after this protocol is typically greater than 90% as determined by SDS-PAGE .

How does MT-CO2 sequence variation correlate with divergence times in the chipmunk radiation?

Analysis of MT-CO2 sequence variation has revealed important insights into the timing and pattern of divergence within the chipmunk genus Tamias. Studies have shown that the maximum mitochondrial DNA percent divergence between closely related chipmunk species ranges from 3.2% to 10.0%, corresponding to divergence times of approximately 0.35 to 2.75 million years . This molecular clock approach has helped researchers understand the recent radiation of chipmunks across North America.

Interestingly, MT-CO2 sequence data has revealed extensive mitochondrial DNA introgression between some chipmunk species. For instance, 65% of T. dorsalis individuals carry mitochondrial DNA that originated from T. cinereicollis, suggesting historical hybridization events approximately 1.33 million years ago . These findings highlight the complex evolutionary history of chipmunks and demonstrate that species boundaries can remain porous long after initial divergence. Researchers should consider this potential for introgression when using MT-CO2 for phylogenetic analyses.

What experimental approaches can address the potential functional differences between recombinant and native MT-CO2?

To assess functional differences between recombinant and native MT-CO2, researchers should consider several complementary approaches:

  • Enzyme kinetics analysis: Compare the cytochrome c oxidase activity of purified recombinant MT-CO2 (reconstituted with other subunits) versus the native enzyme isolated from mitochondria. Measure oxygen consumption rates using a Clark-type oxygen electrode under varying substrate concentrations to determine Km and Vmax values.

  • Structural analysis: Employ circular dichroism spectroscopy to compare secondary structure elements between recombinant and native proteins. More detailed structural information can be obtained through X-ray crystallography or cryo-electron microscopy if sufficient quantities of protein are available.

  • Protein-protein interaction studies: Use co-immunoprecipitation or surface plasmon resonance to assess whether recombinant MT-CO2 retains the ability to interact with other subunits of the cytochrome c oxidase complex.

  • Post-translational modification mapping: Use mass spectrometry to identify and compare post-translational modifications between native and recombinant forms, as these modifications can significantly impact protein function.

  • In vitro reconstitution assays: Attempt to reconstitute functional cytochrome c oxidase complexes using recombinant MT-CO2 and other purified subunits, then assess activity compared to the native complex .

How can MT-CO2 be used as a biomarker for mitochondrial disorders in comparative animal studies?

MT-CO2 has potential as a biomarker for mitochondrial disorders due to its essential role in oxidative phosphorylation. In human studies, MT-CO2 has been identified as a biomarker for conditions such as MELAS syndrome and is associated with Huntington's disease and stomach cancer . In comparative animal studies, researchers can:

  • Quantify MT-CO2 expression levels: Using quantitative PCR or western blotting to compare MT-CO2 expression between healthy animals and those with suspected mitochondrial dysfunction. Decreased levels may indicate impaired mitochondrial function.

  • Assess enzyme activity: Measure cytochrome c oxidase activity in tissue homogenates or isolated mitochondria using standardized assays. Reduced activity can indicate mitochondrial dysfunction.

  • Sequence analysis: Screen for mutations in the MT-CO2 gene that might impact protein function. Known pathogenic mutations in humans can serve as reference points for identifying potentially significant mutations in animal models.

  • Tissue-specific expression profiling: Examine MT-CO2 expression across different tissues (as shown in the human proteome map) to identify tissue-specific alterations in mitochondrial function .

  • Correlation with physiological parameters: Correlate MT-CO2 levels or activity with physiological parameters such as exercise capacity, metabolic rate, and thyroid hormone levels, as these have been shown to be affected by mitochondrial function in studies of rodents .

What are the critical factors affecting solubility of recombinant MT-CO2 during expression?

Recombinant MT-CO2 solubility can be challenging due to its hydrophobic nature as a membrane protein. Critical factors affecting solubility include:

  • Expression temperature: Lower temperatures (16-18°C) generally improve solubility by slowing protein synthesis and folding rates.

  • Induction conditions: Lower IPTG concentrations (0.1-0.5 mM) can reduce aggregation by decreasing the rate of protein production.

  • Host strain selection: Strains expressing rare tRNAs (like Rosetta) or chaperones (like Arctic Express) may improve folding and solubility.

  • Buffer composition: During lysis and purification, including mild detergents (0.1-1% Triton X-100, n-dodecyl-β-D-maltoside, or CHAPS) helps solubilize the protein without denaturing it.

  • Fusion partners: Using solubility-enhancing fusion partners such as SUMO, thioredoxin, or MBP can dramatically improve solubility.

  • Codon optimization: Optimizing the coding sequence for E. coli can prevent translational stalling and improve folding.

  • Inclusion of stabilizing agents: Adding glycerol (10-20%), arginine (50-100 mM), or proline (25-50 mM) to buffers can enhance protein stability and solubility .

If inclusion bodies form despite these measures, protocols for solubilization using 8M urea or 6M guanidine hydrochloride followed by on-column refolding during purification can be employed, though activity may be compromised.

How can researchers verify the functional integrity of purified recombinant MT-CO2?

Verifying the functional integrity of purified recombinant MT-CO2 is crucial before using it in downstream applications. Recommended approaches include:

  • Spectroscopic analysis: MT-CO2 contains metal-binding sites that give characteristic absorption spectra. UV-visible spectroscopy can reveal whether the protein has properly incorporated its metal cofactors.

  • Circular dichroism (CD): CD spectroscopy can confirm proper secondary structure formation, which is essential for function.

  • Limited proteolysis: Correctly folded proteins show distinct and limited digestion patterns compared to misfolded variants when subjected to controlled proteolytic digestion.

  • Thermal shift assays: These can assess protein stability and folding by monitoring protein unfolding in response to increasing temperature.

  • Activity assays: Although isolated MT-CO2 lacks the complete cytochrome c oxidase activity, researchers can measure partial reactions or reconstitute the complex with other purified subunits to assess functionality.

  • Binding assays: Surface plasmon resonance or isothermal titration calorimetry can determine whether the recombinant protein retains the ability to bind to known interaction partners.

  • Reconstitution into liposomes: Functional assessment can be performed by reconstituting the protein into liposomes and measuring proton pumping activity .

What are the most common pitfalls in using MT-CO2 for phylogenetic studies and how can they be addressed?

When using MT-CO2 for phylogenetic studies of chipmunks and related species, researchers should be aware of several common pitfalls:

  • Mitochondrial introgression: As evidenced by the high percentage of introgressed MT-CO2 sequences in some chipmunk populations (e.g., 100% in T. a. canicaudus, 65% in T. dorsalis), mitochondrial capture through hybridization can lead to misleading phylogenetic inferences. To address this, researchers should combine MT-CO2 data with nuclear markers and implement multilocus coalescent methods .

  • Heteroplasmy: The presence of multiple mitochondrial genomes within an individual can complicate sequence analysis. Deep sequencing and careful analysis of chromatograms can help identify heteroplasmic sites.

  • Nuclear mitochondrial DNA segments (NUMTs): These are non-functional nuclear copies of mitochondrial genes that can be inadvertently amplified along with the target MT-CO2. Designing primers specific to the authentic mitochondrial sequence and using long-range PCR can help avoid NUMTs.

  • Incomplete lineage sorting: Recently diverged species may show discordance between gene trees and species trees due to incomplete lineage sorting. Using multiple loci and coalescent-based methods can help distinguish between introgression and incomplete lineage sorting.

  • Rate heterogeneity: Although MT-CO2 has a relatively constant evolutionary rate, variations can occur across lineages. Using relaxed clock models in phylogenetic analyses can account for this variation .

How does Tamias sonomae MT-CO2 compare structurally and functionally with homologs from other chipmunk species?

Tamias sonomae MT-CO2 shares high sequence similarity with homologs from other chipmunk species. Comparing the amino acid sequences of T. sonomae and T. cinereicollis MT-CO2 reveals only minor differences, primarily in non-catalytic regions . This high conservation reflects the critical role of MT-CO2 in cellular respiration.

Despite the high sequence similarity, subtle structural variations may contribute to differences in enzymatic efficiency or thermal stability, potentially reflecting adaptations to different environmental conditions across the geographic ranges of these species. For instance, chipmunks from higher elevations or colder regions might exhibit MT-CO2 variants with enhanced catalytic efficiency at lower temperatures.

Functional studies comparing cytochrome c oxidase activity across different chipmunk species could reveal whether these minor sequence variations translate to measurable differences in enzyme kinetics or thermal stability profiles. Such comparative studies would be valuable for understanding how mitochondrial proteins adapt to different environmental conditions while maintaining their essential functions .

What emerging technologies are advancing our understanding of MT-CO2 function and evolution?

Several emerging technologies are enhancing our understanding of MT-CO2:

How can recombinant MT-CO2 be used to study mitochondrial evolution in the context of climate adaptation?

Recombinant MT-CO2 provides a powerful tool for studying how mitochondrial function adapts to different climatic conditions:

  • Enzyme kinetics across temperature gradients: By expressing recombinant MT-CO2 variants from chipmunk species adapted to different climates (from desert to alpine environments), researchers can compare enzyme kinetics across temperature gradients to identify adaptations that optimize performance under specific conditions.

  • Site-directed mutagenesis experiments: Researchers can introduce specific mutations observed in chipmunks from different climatic zones to identify which amino acid substitutions contribute to thermal adaptation.

  • Protein stability assays: Thermal denaturation studies of recombinant MT-CO2 variants can reveal differences in protein stability that may correlate with the thermal environment of the source species.

  • In vitro evolution experiments: Directed evolution of recombinant MT-CO2 under conditions mimicking climate change scenarios can provide insights into potential evolutionary responses.

  • Interaction studies with nuclear-encoded subunits: Co-expression of MT-CO2 with nuclear-encoded cytochrome c oxidase subunits can reveal how mito-nuclear co-adaptation maintains functional integration under different climatic regimes.

This research has particular relevance given observed connections between mitochondrial function and thermal tolerance in mammals, and could provide insights into how species might respond metabolically to climate change .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.