Recombinant Tamias townsendii Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Tamias townsendii (Townsend's chipmunk) (Neotamias townsendii)
Target Names
Target Protein Sequence
MAYPFELGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE IETIWTILPAIILILIALPSLRILYMMDEINDPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLNPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSSSML
Uniprot No.

Target Background

Function

Recombinant Tamias townsendii Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MT-CO2 in Tamias townsendii cellular respiration?

MT-CO2 (Cytochrome c oxidase subunit 2) in Tamias townsendii plays a critical role in the electron transport chain during cellular respiration. This protein is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is crucial for the production of ATP . The protein is encoded by mitochondrial DNA and forms part of Complex IV of the respiratory chain.

In chipmunks, as in other mammals, this protein contains highly conserved functional domains responsible for:

The high degree of conservation in functional domains reflects the essential nature of this protein for cellular metabolism and survival.

How does Tamias townsendii MT-CO2 structure compare to other Tamias species?

Comparative analysis of MT-CO2 across different Tamias species reveals both conserved and variable regions. While no specific structural data for T. townsendii MT-CO2 is directly mentioned in the provided sources, we can draw parallels from studies of other chipmunk species.

The interspecies variation in chipmunk MT-CO2 is likely similar to what has been observed in other closely related species. For instance, in Tigriopus californicus, interpopulation divergence at the COII locus has been measured at nearly 20% at the nucleotide level, including numerous nonsynonymous substitutions . In Tamias species, similar evolutionary patterns might be expected, especially considering the documented divergence with gene flow observed across the chipmunk radiation .

Key structural differences in MT-CO2 typically occur in:

  • External loops exposed to the intermembrane space

  • Regions involved in interactions with nuclear-encoded subunits

  • Domains subjected to different selective pressures based on environmental adaptations

What evolutionary significance does MT-CO2 have in Tamias species?

The MT-CO2 gene serves as an important marker for evolutionary studies in Tamias species. Based on research in related organisms, MT-CO2 in chipmunks likely exhibits significant patterns of molecular evolution that reflect both neutral processes and selective pressures.

In Tigriopus californicus, COII shows evidence that approximately 4% of sites appear to evolve under relaxed selective constraint, while the majority of codons are under strong purifying selection . Similarly, in Tamias species, MT-CO2 can provide insights into:

  • Phylogenetic relationships between populations and species

  • Historical biogeography and range expansions/contractions

  • Adaptations to local environmental conditions

  • Mitonuclear coevolution patterns

The extensive intraspecific nucleotide and amino acid variation observed in other species suggests that MT-CO2 in Tamias townsendii may also exhibit significant population structure, particularly in populations that have been geographically isolated or experienced different selective pressures .

What are the optimal conditions for expressing recombinant Tamias townsendii MT-CO2?

The expression of recombinant Tamias townsendii MT-CO2 requires careful consideration of several experimental parameters. Drawing from related research on mitochondrial proteins:

Expression System Selection:

  • Bacterial systems (E. coli): Suitable for producing high yields but may require codon optimization and refolding

  • Yeast systems (S. cerevisiae): Better for proper folding of mitochondrial proteins

  • Mammalian cell lines: Optimal for post-translational modifications but with lower yields

Optimization Protocol:

  • Clone the MT-CO2 gene into an appropriate expression vector with a strong inducible promoter

  • Add a purification tag (His6 or GST) preferably at the N-terminus

  • Transform into the selected expression system

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Lyse cells under native conditions with appropriate detergents for membrane protein extraction

  • Purify using affinity chromatography followed by size exclusion chromatography

Critical Parameters Table:

ParameterRecommended RangeNotes
Induction temperature16-25°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMFor E. coli systems
Expression duration4-16 hoursLonger at lower temperatures
pH for purification7.2-8.0Maintains native conformation
Detergent0.5-1% Triton X-100 or DDMCritical for solubilizing membrane proteins

How can researchers verify the functional activity of recombinant MT-CO2 in vitro?

Verification of functional activity for recombinant Tamias townsendii MT-CO2 requires assessing its electron transfer capabilities and interaction with other components of the respiratory chain.

Functional Assay Methodology:

  • Cytochrome c Binding Assay:

    • Measure the interaction between recombinant MT-CO2 and cytochrome c using surface plasmon resonance

    • Calculate binding affinities (KD values) under varying pH and ionic strength conditions

  • Electron Transfer Activity:

    • Use spectrophotometric methods to track the oxidation state of cytochrome c

    • Monitor the reduction of artificial electron acceptors in the presence of recombinant MT-CO2

  • Reconstitution into Liposomes:

    • Incorporate recombinant MT-CO2 into artificial membrane systems

    • Measure proton translocation efficiency using pH-sensitive fluorescent dyes

  • Oxygen Consumption Analysis:

    • When integrated with other COX subunits, measure oxygen consumption rates

    • Compare activity to native enzyme isolated from Tamias townsendii mitochondria

Each functional assessment should include positive controls (such as human or mouse MT-CO2) and negative controls (heat-denatured protein) to validate the assay system.

What are the best approaches for studying MT-CO2 polymorphisms across Tamias townsendii populations?

To effectively study MT-CO2 polymorphisms across Tamias townsendii populations, researchers should employ a combination of molecular and computational techniques:

Sampling and DNA Extraction:

  • Collect samples from diverse geographic locations spanning the species range

  • Extract total DNA using standardized protocols for field samples

  • Ensure adequate population representation (minimum 10-15 individuals per population)

Gene Amplification and Sequencing:

  • Design primers specific to conserved regions flanking the MT-CO2 gene

  • Amplify using PCR conditions similar to those used for other Tamias species

  • Sequence using both traditional Sanger sequencing and next-generation sequencing for heteroplasmy detection

Polymorphism Analysis:

  • Align sequences using software such as ClustalW

  • Identify single nucleotide polymorphisms (SNPs) and insertion/deletion variants

  • Calculate nucleotide diversity (π), haplotype diversity, and other population genetic statistics

  • Use restriction fragment length polymorphism (RFLP) analysis with enzymes like AluI for rapid screening of known polymorphisms

Selection Analysis:

  • Calculate the ratio of nonsynonymous to synonymous substitutions (ω)

  • Apply maximum likelihood models of codon substitution to identify sites under selection

  • Use branch-site models to detect lineage-specific selection patterns

This comprehensive approach can reveal patterns similar to those observed in other species, where interpopulation divergence may reach significant levels while intrapopulation divergence remains minimal .

How can MT-CO2 be used to study hybridization in Tamias species complexes?

MT-CO2 provides a valuable tool for studying hybridization in Tamias species complexes due to its maternal inheritance pattern and relatively rapid evolutionary rate.

Methodological Approach:

  • Sampling Strategy:

    • Target sympatric populations of different Tamias species, including T. townsendii

    • Include allopatric populations as reference groups

    • Collect samples from potential hybrid zones

  • Molecular Analysis:

    • Sequence MT-CO2 from all samples

    • Develop species-specific markers based on diagnostic nucleotide positions

    • Compare mitochondrial and nuclear markers to detect mitonuclear discordance

  • Data Analysis for Hybridization Detection:

    • Construct haplotype networks to visualize relationships

    • Identify individuals with mismatched mitochondrial and nuclear genotypes

    • Quantify introgression rates in different geographic regions

Research on other chipmunk species has revealed extensive mitochondrial DNA introgression, with approximately 16% of sampled chipmunks exhibiting introgressed mtDNA . This suggests that MT-CO2 can be particularly informative in detecting historical and ongoing gene flow between Tamias species.

Detection Challenges:

  • Landscape disturbance can complicate field identification and increase hybridization rates

  • Ancient introgression events may be difficult to distinguish from incomplete lineage sorting

  • Selective sweeps on mitochondrial DNA can create patterns resembling introgression

What evidence exists for adaptive evolution in Tamias townsendii MT-CO2?

While specific evidence for adaptive evolution in Tamias townsendii MT-CO2 is not directly presented in the search results, we can draw inferences from related studies:

Potential Signatures of Selection:

  • Nonsynonymous Substitutions:
    In Tigriopus californicus, COII exhibits numerous nonsynonymous substitutions between populations, suggesting potential adaptive changes . Similar patterns might exist in T. townsendii, particularly in populations across environmental gradients.

  • Coevolution with Nuclear-Encoded Proteins:
    The high degree of interaction between MT-CO2 and nuclear-encoded subunits of COX and cytochrome c suggests that compensatory evolution might occur, where changes in MT-CO2 compensate for substitutions in interacting proteins .

  • Branch-Site Specific Selection:
    Studies in T. californicus identified three sites that may have experienced positive selection within specific clades . Similar branch-site analysis for T. townsendii might reveal lineage-specific adaptations.

Environmental Adaptation Hypothesis:
MT-CO2's role in energy production makes it a candidate for adaptation to different environmental conditions. Chipmunks living at different elevations or thermal environments might show adaptive changes in MT-CO2 that optimize respiratory efficiency under their specific conditions, similar to the elevational range shifts observed in Tamias alpinus .

How do mitonuclear interactions influence the evolution of MT-CO2 in chipmunks?

Mitonuclear interactions play a critical role in the evolution of MT-CO2 in chipmunks due to the functional necessity of coordination between mitochondrial-encoded and nuclear-encoded components of the respiratory chain.

Key Aspects of Mitonuclear Coevolution:

  • Compensatory Evolution:

    • Nonsynonymous substitutions in MT-CO2 may be selected to maintain functional compatibility with nuclear-encoded interaction partners

    • This creates a pattern where changes in one genome drive compensatory changes in the other

  • Hybrid Incompatibilities:

    • Mismatches between MT-CO2 and nuclear-encoded proteins in hybrids can lead to reduced fitness

    • This has been observed in interpopulation hybrids between central and northern California populations of Tigriopus californicus

  • Coevolutionary Dynamics:

    • The rate of MT-CO2 evolution may be influenced by the evolution of its nuclear partners

    • Selection may act more strongly on MT-CO2 in populations that have experienced rapid evolution of nuclear-encoded components

Empirical Evidence:
Studies in T. californicus have shown "functional and fitness consequences among interpopulation hybrids," suggesting that mismatches between mitochondrial and nuclear genomes can affect organism performance . In chipmunks, similar mechanisms may contribute to reproductive isolation between diverging populations or species.

How does environmental stress affect MT-CO2 expression in Tamias townsendii?

Environmental stress likely influences MT-CO2 expression in Tamias townsendii, although direct evidence is not provided in the search results. Drawing from studies on related species, we can infer potential patterns:

Stress Response Mechanisms:

  • Temperature Stress:

    • Extreme temperatures may alter MT-CO2 expression to compensate for changes in metabolic demand

    • Cold exposure typically increases expression to support thermogenesis

    • Heat stress may initially increase expression followed by downregulation if damage occurs

  • Elevation-Related Adaptations:

    • Chipmunks at higher elevations might show different baseline expression of MT-CO2

    • This could parallel the patterns seen in other chipmunk species like Tamias alpinus that have undergone upward elevational range contractions

  • Glucocorticoid-Mediated Regulation:

    • Stress hormones likely influence mitochondrial gene expression

    • Different chipmunk species show contrasting stress responses, as documented between T. alpinus and T. speciosus

    • These hormonal differences could correlate with different patterns of MT-CO2 regulation

Experimental Evidence from Related Species:
Research on Alpine chipmunks (T. alpinus) has shown them to be more responsive to several changes in external conditions compared to Lodgepole chipmunks (T. speciosus) . Such species-specific stress responses may extend to differences in how MT-CO2 expression is regulated under stress conditions.

What techniques are most effective for measuring MT-CO2 protein-protein interactions?

Several complementary techniques are effective for investigating MT-CO2 protein-protein interactions, particularly with other components of the respiratory chain:

In Vitro Techniques:

  • Co-Immunoprecipitation (Co-IP):

    • Use antibodies against recombinant MT-CO2 to pull down interacting partners

    • Identify co-precipitated proteins through mass spectrometry

    • Quantify interaction strength under different conditions

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified MT-CO2 on a sensor chip

    • Measure real-time binding kinetics with potential interacting partners

    • Determine association/dissociation constants for each interaction

  • Bioluminescence Resonance Energy Transfer (BRET):

    • Tag MT-CO2 and potential partners with bioluminescent and fluorescent proteins

    • Measure energy transfer as indication of protein proximity

    • Monitor interactions in real-time under varying conditions

Structural Approaches:

  • Cross-linking coupled with Mass Spectrometry:

    • Use chemical cross-linkers to capture transient interactions

    • Digest cross-linked complexes and identify interaction sites by mass spectrometry

    • Map interaction surfaces on the protein structure

  • Cryo-Electron Microscopy:

    • Visualize MT-CO2 in complex with interacting partners

    • Resolve structural details of interaction interfaces

    • Compare structures under different functional states

Experimental Considerations Table:

TechniqueResolutionAdvantagesLimitations
Co-IPLowWorks with endogenous proteinsIndirect evidence for interactions
SPRMediumQuantitative binding kineticsRequires purified proteins
BRETMediumFunctions in living cellsRequires protein tagging
Cross-linking MSHighIdentifies specific contact sitesComplex data analysis
Cryo-EMVery highDirect structural visualizationTechnically challenging

How do post-translational modifications affect MT-CO2 function in chipmunks?

Post-translational modifications (PTMs) of MT-CO2 likely play significant roles in regulating its function in chipmunks, although specific data for Tamias townsendii is not directly provided in the search results.

Key Post-translational Modifications:

  • Phosphorylation:

    • Likely occurs on serine, threonine, or tyrosine residues

    • May regulate electron transfer efficiency or protein-protein interactions

    • Could be modulated in response to metabolic demands or stress conditions

  • Acetylation:

    • May occur on lysine residues

    • Could influence protein stability or interaction with cytochrome c

    • Potentially responds to changes in cellular energy status

  • Oxidative Modifications:

    • Includes carbonylation and nitration

    • Increases during oxidative stress

    • May impair function and target the protein for degradation

Functional Consequences:

PTMs of MT-CO2 could influence critical aspects of mitochondrial function, including:

  • Electron transfer efficiency

  • Assembly of the cytochrome c oxidase complex

  • Protein half-life and turnover rates

  • Response to various environmental stressors

Differences in PTM patterns between chipmunk species or populations might contribute to variations in metabolic efficiency, which could be particularly important for species experiencing different environmental pressures, such as the contrasting stress responses observed between T. alpinus and T. speciosus .

How can MT-CO2 markers help monitor Tamias townsendii population health and genetic diversity?

MT-CO2 markers provide valuable tools for monitoring population health and genetic diversity in Tamias townsendii, offering insights that can inform conservation strategies.

Applications in Population Monitoring:

  • Genetic Diversity Assessment:

    • Sequence MT-CO2 from multiple individuals across populations

    • Calculate nucleotide diversity, haplotype diversity, and other metrics

    • Monitor changes in genetic diversity over time as indicators of population health

  • Population Structure Analysis:

    • Use MT-CO2 haplotypes to identify genetically distinct populations

    • Assess gene flow between habitat fragments

    • Identify populations with unique genetic variants for conservation prioritization

  • Genetic Bottleneck Detection:

    • Compare current genetic diversity with historical samples

    • Identify loss of rare haplotypes

    • Estimate effective population size changes

Methodological Approach:

  • Non-invasive sampling (hair, feces) to minimize impact on wild populations

  • PCR amplification and sequencing of MT-CO2

  • RFLP analysis for rapid screening of known population-specific markers

  • Comparative analysis with other genetic markers to provide a comprehensive assessment

Studies on other chipmunk species have demonstrated how molecular markers can track population changes, such as the upward range contraction observed in T. alpinus in Yosemite National Park over the past century .

What insights can MT-CO2 provide about Tamias townsendii adaptation to climate change?

MT-CO2 analysis can offer valuable insights into how Tamias townsendii is adapting to climate change, particularly given its role in energy metabolism.

Key Research Approaches:

  • Temporal Sampling:

    • Compare MT-CO2 sequences from historical specimens with contemporary samples

    • Identify directional changes in allele frequencies that correlate with climate trends

    • Assess whether observed changes are consistent with adaptive evolution

  • Spatial Analysis:

    • Sample across elevational or latitudinal gradients

    • Correlate MT-CO2 variants with environmental variables (temperature, precipitation)

    • Test for signals of selection in populations from different climatic regions

  • Functional Validation:

    • Express different MT-CO2 variants under simulated climate conditions

    • Measure energetic efficiency across a range of temperatures

    • Assess whether certain variants confer advantages under predicted future climate scenarios

Relevance to Climate Change Research:
Studies on alpine chipmunks (T. alpinus) have documented significant upward contractions in elevational range over the past century, contrasting with no significant change in the lodgepole chipmunk (T. speciosus) . These different responses to environmental change might be partly explained by differences in metabolic adaptations, potentially involving MT-CO2 and other genes involved in energy metabolism.

How does MT-CO2 variation correlate with physiological performance in different habitats?

The correlation between MT-CO2 variation and physiological performance in Tamias townsendii likely varies across different habitats, reflecting adaptive responses to local environmental conditions.

Research Framework:

  • Integrated Phenotype Assessment:

    • Measure multiple performance metrics (metabolic rate, thermal tolerance, exercise capacity)

    • Sequence MT-CO2 from the same individuals

    • Test for associations between specific variants and performance traits

  • Habitat-Specific Performance:

    • Compare chipmunks from contrasting habitats (high vs. low elevation, dry vs. mesic)

    • Assess whether MT-CO2 variants correlate with habitat-specific performance advantages

    • Control for other factors using common garden experiments

  • Stress Response Integration:

    • Measure both baseline and stress-induced physiological responses

    • Assess whether MT-CO2 variants interact with stress response pathways

    • This approach may reveal patterns similar to the species-specific stress responses documented between T. alpinus and T. speciosus

Experimental Design Table:

MeasurementTechniqueRelevance to MT-CO2 Function
Resting metabolic rateRespirometryDirect measure of energetic efficiency
Maximum oxygen consumptionTreadmill exercise testPerformance under high energy demand
Thermal toleranceCritical temperature testAdaptation to temperature extremes
Stress hormone responseFecal cortisol metabolitesIntegration with stress physiology
Mitochondrial functionTissue biopsies for respirometryDirect assessment of OXPHOS efficiency

Understanding these relationships could help explain why some chipmunk species show greater sensitivity to environmental change than others, as documented in the contrasting responses of T. alpinus and T. speciosus to climate change in Yosemite National Park .

What are the main challenges in expressing functional recombinant MT-CO2 protein?

Expressing functional recombinant MT-CO2 protein presents several significant challenges that researchers must overcome:

Key Technical Challenges:

  • Hydrophobic Nature:

    • MT-CO2 contains transmembrane domains that make it difficult to express in soluble form

    • Requires specialized detergents or membrane mimetics for proper folding

    • Often forms inclusion bodies in bacterial expression systems

  • Post-translational Processing:

    • Mitochondrial proteins undergo specific processing in their native environment

    • Recombinant systems may lack the machinery for proper modifications

    • Improper processing can affect protein stability and function

  • Protein-Protein Interactions:

    • MT-CO2 normally functions as part of a multi-subunit complex

    • Isolation may disrupt critical interactions necessary for stability

    • Recombinant protein may lack proper conformational states

Methodological Solutions:

  • Use specialized expression systems designed for membrane proteins

  • Co-express with chaperones to aid proper folding

  • Employ fusion tags that enhance solubility

  • Express in eukaryotic systems that provide more appropriate processing

This approach is similar to methodologies used for expressing other membrane proteins and components of electron transport chains, such as those described for analyzing Trypanosoma proteins .

How can next-generation sequencing advance our understanding of MT-CO2 evolution in Tamias species?

Next-generation sequencing (NGS) technologies offer powerful approaches to advance our understanding of MT-CO2 evolution in Tamias species:

Innovative Applications:

  • Population-Scale Genomics:

    • Sequence MT-CO2 from hundreds or thousands of individuals across multiple populations

    • Identify rare variants and map their geographic distribution

    • Calculate more accurate population genetic statistics than possible with traditional methods

  • Environmental DNA (eDNA) Monitoring:

    • Detect Tamias species presence from environmental samples

    • Track population movements and range shifts using MT-CO2 as a marker

    • Monitor community composition in areas with multiple chipmunk species

  • Ancient DNA Analysis:

    • Sequence MT-CO2 from museum specimens collected over the past century

    • Track temporal changes in genetic diversity and selection pressures

    • Correlate genetic changes with documented environmental changes

  • Single-Cell Applications:

    • Analyze MT-CO2 expression at the single-cell level

    • Identify cell-specific responses to environmental stressors

    • Detect heteroplasmy (multiple mitochondrial genotypes within a single individual)

Methodological Advances:

NGS approaches like those used in the COII-RFLP analysis of Trypanosoma can be adapted to study chipmunk MT-CO2, allowing for high-throughput analysis of genetic diversity and selection patterns across multiple species and populations simultaneously.

What is the potential for using CRISPR-Cas9 to study MT-CO2 function in Tamias townsendii cells?

The application of CRISPR-Cas9 technology to study MT-CO2 function in Tamias townsendii cells represents a frontier in understanding the molecular biology of this species, though it presents unique challenges:

Innovative Applications:

  • Mitochondrial Genome Editing:

    • Direct modification of MT-CO2 sequence to test functional hypotheses

    • Introduction of specific variants identified in wild populations

    • Creation of chimeric MT-CO2 variants combining sequences from different populations

  • Nuclear-Mitochondrial Interactions:

    • Edit nuclear-encoded interaction partners of MT-CO2

    • Create cellular models with mismatched mitochondrial and nuclear genomes

    • Test hypotheses about mitonuclear coevolution and compatibility

  • Reporter Systems:

    • Integrate reporters to monitor MT-CO2 expression and localization

    • Track responses to environmental stressors in real-time

    • Visualize protein-protein interactions in living cells

Technical Challenges:

  • Mitochondrial Targeting:

    • Difficulty in delivering CRISPR-Cas9 components to mitochondria

    • Need for specialized mitochondrial targeting sequences

    • Lower efficiency compared to nuclear genome editing

  • Cell Culture Development:

    • Limited availability of Tamias townsendii cell lines

    • Need to establish primary cell cultures or fibroblast lines

    • Optimization of culture conditions for chipmunk cells

  • Functional Assessment:

    • Development of assays to measure MT-CO2 function in edited cells

    • Correlation of cellular phenotypes with whole-organism traits

    • Translation of in vitro findings to ecological relevance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.