Recombinant Tarsius bancanus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Tarsius bancanus Cytochrome c Oxidase Subunit 2 (MT-CO2)

Recombinant Tarsius bancanus Cytochrome c oxidase subunit 2 (MT-CO2) refers to a genetically engineered version of the Cytochrome c oxidase subunit 2 gene from the Bornean tarsier (Tarsius bancanus). This gene is part of the mitochondrial DNA and plays a crucial role in the electron transport chain, facilitating the process of oxidative phosphorylation to produce ATP. The MT-CO2 gene is often used as a molecular marker in phylogenetic studies due to its high variability and conserved function across different species.

Role of MT-CO2 in Phylogenetic Analysis

The MT-CO2 gene is widely used in phylogenetic research because it provides valuable information about evolutionary relationships among species. Its high mutation rate compared to other mitochondrial genes makes it an effective tool for distinguishing between closely related species or populations. In the context of Tarsius bancanus, the MT-CO2 gene helps in understanding the genetic diversity and evolutionary history of this primate species.

Research Findings on Tarsius Species Using MT-CO2

Research on Tarsius species, including T. bancanus, has utilized the MT-CO2 gene to analyze phylogenetic relationships. For example, studies have compared the MT-CO2 sequences of different Tarsius species to assess their genetic similarity and divergence. These analyses often involve aligning sequences from various species and calculating genetic distances to infer evolutionary relationships.

Example Data: Genetic Similarity of MT-CO2 Sequences Among Tarsius Species

Species ComparisonGenetic Similarity (%)
T. bancanus 1 vs. T. bancanus 2100.00
T. bancanus vs. T. syrichta85.18
T. bancanus vs. T. dentatus86.25
T. bancanus vs. T. wallacei85.71

Table 1: Genetic similarity of MT-CO2 sequences among different Tarsius species. The data illustrates the high genetic similarity between individuals of the same species and lower similarity between different species.

Methodology for Analyzing MT-CO2 Sequences

The analysis of MT-CO2 sequences typically involves several steps:

  • DNA Extraction: Tissue samples are collected, and DNA is extracted using kits like the innuPREP DNA micro kit.

  • PCR Amplification: Specific primers are used to amplify the MT-CO2 gene from the extracted DNA.

  • Sequencing: The amplified DNA is sequenced to obtain the MT-CO2 gene sequence.

  • Alignment and Analysis: Sequences are aligned using software like Clustal-X, and genetic distances are calculated to infer phylogenetic relationships.

References:

  • Aloysius Duran Corebima et al. (2017). The Phylogeny of Tarsius tarsier form Buton, Indonesia Based on MT-CO2 Gene. International Journal of Science and Research Methodology, 7(1), 41-55 .

  • Dewoody et al. (2010). Genetic diversity and population structure in a wide range of species.

  • Gil & Brumm (2014). Genetic distances and phylogenetic analysis.

  • Read (2017). Phylogenetic analysis using molecular markers.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Cephalopachus bancanus (Western tarsier) (Tarsius bancanus)
Target Names
Target Protein Sequence
MAHSFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIITLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYLMDEINTPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTADLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLMSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFENWSTSMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme a of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, composed of heme a3 and CuB. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 and what is its biological significance?

Cytochrome c oxidase subunit 2 (MT-CO2 or COX2) is one of the core subunits of mitochondrial Cytochrome c oxidase (Complex IV), a large transmembrane protein complex essential for cellular respiration. This subunit contains a dual core CuA active site and is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, a crucial step in the production of ATP during cellular respiration . In the specific case of Tarsius bancanus (Western tarsier), the MT-CO2 protein consists of 227 amino acid residues with distinctive structural features that enable its electron transfer function .

The biological significance of MT-CO2 extends beyond basic energy metabolism. Recent research indicates that cytochrome c oxidase activity serves as a metabolic checkpoint that regulates cell fate decisions, particularly in immune cells. For instance, in T cells, COX activity increases during activation without necessarily requiring augmented synthesis of COX subunits, suggesting post-translational regulation plays a significant role in modulating its function .

What are the optimal conditions for expressing recombinant Tarsius bancanus MT-CO2 in E. coli systems?

Expressing recombinant Tarsius bancanus MT-CO2 in E. coli requires careful optimization of expression systems and conditions. Based on successful expression of similar proteins, the following methodological approach is recommended:

  • Vector Selection: Use pET-based expression vectors such as pET-32a, which allow for fusion with tags like His-tag for easier purification. The N-terminal His-tag fusion has been successfully employed for Tarsius bancanus MT-CO2 .

  • Host Strain Selection: E. coli strains optimized for protein expression, such as Transetta (DE3), have demonstrated success with similar COX2 proteins. These strains often contain modifications that enhance protein folding or reduce proteolysis .

  • Induction Conditions: Induce protein expression using isopropyl β-D-thiogalactopyranoside (IPTG) at concentrations typically between 0.1-1.0 mM. For optimal expression, induction should be performed when bacterial cultures reach mid-log phase (OD600 of 0.6-0.8) .

  • Temperature and Duration: Lower temperatures (16-25°C) during induction often improve soluble protein yield by slowing expression and allowing proper folding. Extended induction periods (overnight to 24 hours) at these lower temperatures may be necessary for optimal protein production .

  • Media Composition: Enriched media such as Terrific Broth (TB) or Super Broth (SB) can enhance protein yields compared to standard LB media. For difficult-to-express membrane proteins like MT-CO2, specialized media supplements may improve results.

The above parameters should be systematically optimized through small-scale expression trials before scaling up to larger production volumes.

What purification strategies are most effective for recombinant MT-CO2?

Purifying recombinant Tarsius bancanus MT-CO2 requires a multi-step approach to obtain high-purity protein suitable for functional studies:

  • Affinity Chromatography: For His-tagged MT-CO2, Ni²⁺-NTA agarose affinity chromatography represents the most efficient first purification step. This method has successfully yielded purified recombinant COXII protein from similar expression systems . The protein should be eluted using an imidazole gradient (typically 20-250 mM) in an appropriate buffer system maintaining protein stability.

  • Buffer Optimization: Purification buffers should typically contain:

    • 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

    • 100-300 mM NaCl to maintain protein solubility

    • 5-10% glycerol to enhance stability

    • Potentially mild detergents (0.01-0.1%) if protein aggregation is observed

  • Secondary Purification: Following affinity chromatography, size exclusion chromatography (SEC) can further enhance purity by separating the target protein from aggregates and contaminating proteins of different molecular weights.

  • Quality Control: Assess protein purity using SDS-PAGE (>90% purity is generally targeted) and confirm identity using Western blotting with anti-His antibodies. For recombinant MT-CO2 with His-tag, expect a band at approximately 26.2 kDa plus the tag size (typically adding ~4-6 kDa depending on the exact tag configuration) .

  • Storage Conditions: Store purified protein at -20°C/-80°C after adding glycerol to a final concentration of 50%. For long-term storage, aliquot the protein to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

How can the enzymatic activity of recombinant MT-CO2 be assessed in vitro?

Evaluating the enzymatic activity of recombinant Tarsius bancanus MT-CO2 requires specific assays that measure electron transfer function. The following methodological approaches can be employed:

  • Cytochrome c Oxidation Assay: This spectrophotometric assay measures the ability of MT-CO2 to catalyze the oxidation of reduced cytochrome c, which can be monitored by the decrease in absorbance at 550 nm. This approach has been successfully employed for COXII functional analysis . The reaction mixture typically contains:

    • Recombinant MT-CO2 protein (10-50 μg/mL)

    • Reduced cytochrome c (50-100 μM)

    • Appropriate buffer (often phosphate buffer, pH 7.4)

    • Potential cofactors (copper ions)

  • Oxygen Consumption Measurement: Using oxygen electrodes or plate-based respirometry systems to directly measure oxygen consumption during the enzymatic reaction provides another quantitative measure of activity.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: This technique can assess the redox state of the copper centers in MT-CO2, providing detailed information about the electronic structure and functional status of the active site.

  • Stopped-Flow Kinetic Analysis: For detailed kinetic parameter determination, stopped-flow techniques coupled with spectroscopic detection enable measurement of rapid reaction phases and binding constants.

Functional data should be analyzed using appropriate enzyme kinetics models to determine parameters such as Km, kcat, and reaction mechanism details.

What structural analysis techniques are most informative for studying MT-CO2?

Several complementary structural analysis techniques can provide valuable insights into the structure-function relationship of recombinant Tarsius bancanus MT-CO2:

  • Circular Dichroism (CD) Spectroscopy: CD provides information about the secondary structure composition (α-helices, β-sheets) and can be used to assess proper folding and structural integrity of the recombinant protein.

  • Fourier-Transform Infrared (FTIR) Spectroscopy: FTIR spectroscopy can provide detailed information about protein structure and has been successfully applied to analyze recombinant COXII function and interactions with substances like allyl isothiocyanate (AITC) .

  • X-ray Crystallography: While challenging for membrane proteins, this technique provides the highest resolution structural information if crystals can be obtained. Detergent screening is typically necessary for membrane proteins like MT-CO2.

  • Cryo-Electron Microscopy (cryo-EM): This technique has revolutionized structural biology of membrane proteins and can provide near-atomic resolution structures without crystallization.

  • Molecular Dynamics Simulations: Computational approaches can model protein dynamics and predict interactions with substrates or inhibitors. For instance, molecular docking studies have identified potential binding sites for small molecules like AITC on COXII proteins .

How does MT-CO2 function integrate with cellular metabolic networks?

Cytochrome c oxidase subunit 2 functions as a critical component in cellular energy metabolism networks, with implications extending beyond basic respiration:

  • Metabolic Checkpoint Function: Recent research reveals that cytochrome c oxidase activity serves as a metabolic checkpoint that regulates cell fate decisions. In T cells, for example, COX activity increases during activation without requiring increased synthesis of COX subunits, suggesting post-translational regulation .

  • Cellular Respiration Integration: MT-CO2 plays a crucial role in the electron transport chain, accepting electrons from cytochrome c and facilitating their transfer to oxygen, the final electron acceptor. This process is coupled to proton pumping across the inner mitochondrial membrane, contributing to the proton gradient used for ATP synthesis .

  • Metabolic Flexibility Regulation: Studies have shown that cells cultured in different carbon sources (glucose versus galactose) exhibit different dependencies on respiratory chain function. For instance, when galactose is the carbon source, cells rely entirely on the respiratory chain for ATP production, making COX function essential for survival .

  • Cellular Proliferation Control: Functional COX activity is required for proper cell proliferation. In T cells with impaired COX function (as in TCox10−/− models), proliferation is severely compromised, and cells show increased apoptosis after activation .

  • Redox Signaling Networks: Beyond energy production, MT-CO2 function may influence cellular redox signaling networks through its involvement in ROS generation and regulation, which has implications for cell signaling pathways.

What are the implications of MT-CO2 variation in evolutionary studies?

The molecular evolution of MT-CO2 provides fascinating insights into evolutionary processes and species adaptation:

  • Positive Selection Signatures: Analysis of COII genes across species and populations reveals that while most codons are under strong purifying selection (ω << 1), approximately 4% of sites appear to evolve under relaxed selective constraint (ω = 1). In some lineages, specific codons show evidence of positive selection, suggesting adaptive evolution .

  • Coevolution with Nuclear-Encoded Partners: The high degree of interaction between mitochondrial-encoded COX2 and nuclear-encoded components of the respiratory chain suggests mitonuclear coevolution. This is evidenced by studies showing that interpopulation hybrids between geographically separated populations can exhibit reduced fitness due to incompatibilities between mitochondrial and nuclear genes .

  • Population Genetics Applications: The extensive interpopulation divergence observed in some species (up to 20% at the nucleotide level in Tigriopus californicus) makes MT-CO2 an excellent marker for population genetics studies and investigation of allopatric speciation processes .

  • Phylogenetic Utility: The combination of conserved and variable regions in MT-CO2 makes it useful for phylogenetic reconstruction at various taxonomic levels, from closely related species to deeper evolutionary relationships.

  • Functional Consequences of Variation: Nonsynonymous substitutions in MT-CO2 can affect protein function, potentially leading to differences in metabolic efficiency and adaptation to different environments or metabolic demands across species and populations.

What are common challenges in recombinant expression of MT-CO2 and how can they be addressed?

Recombinant expression of membrane proteins like MT-CO2 presents several challenges that researchers should anticipate and address:

  • Protein Insolubility/Inclusion Body Formation:

    • Problem: MT-CO2 may form insoluble inclusion bodies in E. coli.

    • Solutions:

      • Reduce expression temperature to 16-20°C

      • Use specialized E. coli strains (Rosetta, Origami, SHuffle)

      • Co-express with molecular chaperones

      • Try fusion partners that enhance solubility (SUMO, MBP, TrxA)

  • Low Expression Levels:

    • Problem: Poor expression yield of functional protein.

    • Solutions:

      • Optimize codon usage for E. coli

      • Test different promoter strengths

      • Screen multiple expression vectors and host strains

      • Explore auto-induction media systems

  • Protein Degradation:

    • Problem: Rapid degradation of expressed protein.

    • Solutions:

      • Add protease inhibitors during purification

      • Use protease-deficient host strains

      • Optimize buffer conditions (pH, salt concentration)

      • Reduce time between induction and harvest

  • Loss of Activity During Purification:

    • Problem: Purified protein lacks enzymatic activity.

    • Solutions:

      • Include stabilizing agents (glycerol, specific lipids)

      • Use mild detergents for membrane protein extraction

      • Test buffer systems that maintain native-like environment

      • Consider adding cofactors (copper ions for MT-CO2)

  • Tag Interference with Function:

    • Problem: His-tag or other fusion tags interfere with protein function.

    • Solutions:

      • Compare N-terminal vs. C-terminal tag placement

      • Include cleavable tags with appropriate proteases

      • Test tag-free purification strategies

How can researchers optimize storage conditions for long-term stability of recombinant MT-CO2?

Maintaining long-term stability of purified recombinant MT-CO2 requires careful consideration of storage conditions:

  • Buffer Composition Optimization:

    • The choice of buffer significantly impacts protein stability. For MT-CO2, Tris/PBS-based buffers with 6% trehalose at pH 8.0 have been successfully used .

    • Consider adding stabilizing agents such as glycerol (final concentration 50%) to prevent freeze-thaw damage .

    • For membrane proteins, specific lipids or mild detergents may be required to maintain native-like environment.

  • Aliquoting Strategy:

    • Divide purified protein into small single-use aliquots to avoid repeated freeze-thaw cycles, which are particularly damaging for complex proteins like MT-CO2 .

    • Use small-volume, high-concentration aliquots when possible.

  • Storage Temperature Selection:

    • Long-term storage: -80°C is optimal for maintaining activity over months to years.

    • Medium-term storage: -20°C may be sufficient for many applications.

    • Short-term working stocks: 4°C for up to one week .

  • Lyophilization Considerations:

    • Lyophilization (freeze-drying) can extend shelf-life dramatically if properly executed.

    • Protective excipients such as trehalose (6%) help maintain protein structure during lyophilization and rehydration .

    • Validate activity after reconstitution to ensure the process preserves function.

  • Reconstitution Protocol:

    • Centrifuge vials briefly before opening to bring contents to the bottom.

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

    • For optimal preservation, add glycerol to a final concentration of 5-50% .

How should researchers interpret functional assay results in the context of evolutionary conservation?

Interpreting functional assay results for recombinant MT-CO2 requires consideration of evolutionary context:

What statistical approaches are appropriate for analyzing MT-CO2 functional variation across species?

Analyzing functional variation of MT-CO2 across species requires robust statistical approaches:

  • Phylogenetic Comparative Methods:

    • Account for phylogenetic non-independence when comparing functional parameters across species.

    • Use phylogenetic generalized least squares (PGLS) or phylogenetic ANOVA to test for correlations between MT-CO2 properties and ecological/physiological traits.

    • Employ phylogenetically independent contrasts to identify evolutionary associations while controlling for shared ancestry.

  • Molecular Evolution Statistical Tests:

    • Maximum likelihood models of codon substitution can quantify selection pressures.

    • Branch-site models can identify lineage-specific changes in selection pressure.

    • Site-specific models can pinpoint individual codons under different selection regimes .

  • Structure-Based Statistical Approaches:

    • Analyze the spatial distribution of substitutions using 3D structural models.

    • Test for clustering of substitutions in functional domains using spatial statistics.

    • Employ ConSurf or similar tools to map conservation scores onto structural models.

  • Multivariate Analysis for Complex Phenotypes:

    • Principal component analysis (PCA) can identify patterns of covariation in multiple functional parameters.

    • Discriminant function analysis can classify species based on MT-CO2 functional profiles.

    • Hierarchical clustering can group species with similar MT-CO2 properties.

  • Bayesian Approaches for Integrating Multiple Data Types:

    • Bayesian statistical frameworks can incorporate uncertainty in phylogenetic relationships and functional measurements.

    • Markov chain Monte Carlo (MCMC) methods can estimate posterior distributions of parameters in complex evolutionary models.

    • Bayesian networks can model complex relationships between sequence, structure, and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.