Recombinant Tarsius bancanus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what is its fundamental function in cellular metabolism?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein subunit of mitochondrial Complex I, which is the first enzyme of the electron transport chain. This protein is encoded by the mitochondrial genome and forms part of the core structure of NADH dehydrogenase (ubiquinone). The primary function of MT-ND4L is to participate in the electron transfer process from NADH to coenzyme Q10 (ubiquinone) and contribute to proton translocation across the inner mitochondrial membrane, which is essential for generating the electrochemical gradient used in ATP production through oxidative phosphorylation .

MT-ND4L is one of seven mitochondrially encoded subunits of Complex I, which also include MT-ND1, MT-ND2, MT-ND3, MT-ND4, MT-ND5, and MT-ND6. Together, these components form the core of the transmembrane region of Complex I, which is critical for its proton-pumping function. The electron transport coupled with proton translocation helps establish the proton gradient that drives ATP synthesis, making MT-ND4L essential for cellular energy production .

What is the molecular structure and characteristics of Tarsius bancanus MT-ND4L?

The Tarsius bancanus MT-ND4L is a relatively small protein of 98 amino acids with a molecular weight of approximately 11 kDa. According to available sequence data, the amino acid sequence is: MPYIYTNLFLAFLTSL LGMLIYRSHLMSSLLCLEGMMLSMFIMTSL TILNLHFTLSNMIPIPIILLVFAACEAAVGLALLVMVSNTYGLDYV QNLNLLQC .

This protein is highly hydrophobic, which reflects its function as a membrane-embedded component of the respiratory Complex I. The hydrophobic nature allows it to be integrated into the inner mitochondrial membrane, where it contributes to the core structure of the transmembrane domain of Complex I. Like other mitochondrially encoded subunits of Complex I, Tarsius bancanus MT-ND4L is characterized by its hydrophobicity and is believed to be crucial for the assembly and stability of the complex, as well as for its proton-pumping function .

How is the MT-ND4L gene organized in the mitochondrial genome?

In humans and presumably in Tarsius bancanus with similar organization, the MT-ND4L gene is located in the mitochondrial genome. Based on human data, this gene typically spans from base pair 10,469 to 10,765 in the mitochondrial DNA. An interesting feature of the MT-ND4L gene is its 7-nucleotide overlap with the MT-ND4 gene. Specifically, the last three codons of MT-ND4L (5'-CAA TGC TAA-3' coding for Gln, Cys, and Stop) overlap with the first three codons of the MT-ND4 gene (5'-ATG CTA AAA-3' coding for Met-Leu-Lys) .

This gene organization demonstrates an economic use of the compact mitochondrial genome, where genes may overlap to maximize coding capacity within the limited space. Such overlapping gene arrangements are relatively common in mitochondrial genomes and represent an evolutionary strategy to maintain essential genetic information within the constraints of a small genome size .

What are the optimal conditions for handling and storing recombinant Tarsius bancanus MT-ND4L?

For optimal handling and storage of recombinant Tarsius bancanus MT-ND4L, researchers should adhere to specific protocols to maintain protein integrity and activity. The commercial recombinant protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein. For long-term storage, the protein should be maintained at -20°C, or preferably at -80°C for extended preservation periods .

It is crucial to avoid repeated freeze-thaw cycles as these can significantly compromise protein stability and functionality. Instead, researchers should prepare working aliquots upon first thawing and store these at 4°C if they are to be used within one week. When preparing experiments, the protein should be thawed on ice and handled minimally at room temperature to prevent degradation. Additionally, considering the hydrophobic nature of MT-ND4L, specialized detergents or lipid environments may be necessary when designing experiments to maintain the protein in its native conformation .

How can researchers validate the functionality of recombinant MT-ND4L in experimental settings?

Validating the functionality of recombinant MT-ND4L requires multiple approaches due to its role as part of the larger Complex I. Here are methodological strategies researchers can employ:

• Complex I Assembly Assays: Researchers can assess whether the recombinant MT-ND4L can successfully incorporate into Complex I structures using blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by immunoblotting with antibodies against Complex I subunits.

• NADH:Ubiquinone Oxidoreductase Activity Measurements: The enzymatic activity of Complex I can be measured spectrophotometrically by monitoring the oxidation of NADH at 340 nm in the presence of ubiquinone. Researchers can compare activity with and without the incorporation of recombinant MT-ND4L to determine its functional contribution .

• Proton Translocation Assays: Since Complex I functions in proton translocation, researchers can use pH-sensitive fluorescent probes or proteoliposome-based approaches to assess whether the recombinant MT-ND4L contributes to proton pumping activity when integrated into Complex I.

• Structural Studies: Advanced techniques like cryo-electron microscopy can be used to validate whether the recombinant protein adopts the expected structural conformation within the complex, particularly regarding its transmembrane orientation .

What experimental approaches are most effective for studying MT-ND4L mutations and their functional consequences?

To study MT-ND4L mutations and their functional impacts, researchers can employ several sophisticated methodological approaches:

• Site-Directed Mutagenesis: Creating specific mutations in the recombinant MT-ND4L to mimic naturally occurring variants or to test hypotheses about structure-function relationships.

• Cybrid Cell Technology: This involves transferring mitochondria containing MT-ND4L mutations into cells depleted of their own mitochondrial DNA, allowing researchers to study the effects of specific mutations in a controlled nuclear background.

• Seahorse XF Analysis: This technique measures oxygen consumption rates and extracellular acidification to assess mitochondrial respiration and glycolysis in cells expressing mutant versus wild-type MT-ND4L.

• Reactive Oxygen Species (ROS) Measurements: Since Complex I dysfunction often results in increased ROS production, fluorescent probes or other ROS detection methods can quantify how MT-ND4L mutations affect oxidative stress levels.

• In vivo Modeling: Developing animal models (where feasible) with specific MT-ND4L mutations to study systemic effects, particularly in tissues with high energy demands like neural tissue, which is relevant for conditions like Leber hereditary optic neuropathy (LHON) associated with MT-ND4L mutations .

How does Tarsius bancanus MT-ND4L compare structurally and functionally to its homologs in other primates?

Comparative analysis of MT-ND4L across primate species provides valuable insights into evolutionary conservation and adaptation of mitochondrial function. Tarsius bancanus (Western tarsier) represents an interesting research subject as tarsiers occupy a unique evolutionary position between prosimians and anthropoids.

The 98-amino acid sequence of Tarsius bancanus MT-ND4L shows high conservation in key functional domains when compared to other primates, reflecting the essential role of this protein in cellular respiration. Regions involved in proton pumping and integration into the Complex I structure typically show the highest conservation. The hydrophobic character of the protein is maintained across primate species, as this is crucial for its membrane-embedded function .

Researchers examining evolutionary patterns might focus on specific amino acid substitutions between species and how these relate to metabolic adaptations. For instance, species with higher metabolic rates might exhibit adaptive changes in electron transport chain components. Computational approaches such as selection pressure analysis (dN/dS ratios) can identify sites under positive selection across the primate lineage, potentially revealing functional adaptations in MT-ND4L related to environmental or physiological demands .

What can studies of Tarsius bancanus MT-ND4L reveal about mitochondrial evolution in primates?

Studies of Tarsius bancanus MT-ND4L offer unique opportunities to understand mitochondrial evolution due to the distinctive phylogenetic position of tarsiers. As one of the oldest primate lineages that diverged early in primate evolution, tarsiers can provide insights into ancestral mitochondrial functions and subsequent adaptations.

Research methodologies in this area might include:

• Phylogenetic Analysis: Constructing evolutionary trees based on MT-ND4L sequences to clarify relationships between primate lineages and identify patterns of sequence divergence.

• Molecular Clock Analysis: Estimating the timing of evolutionary changes in MT-ND4L to correlate with major evolutionary events or environmental changes.

• Structure-Function Correlation: Mapping sequence differences onto structural models to identify how evolutionary changes might affect protein function.

• Adaptive Evolution Studies: Investigating whether certain regions of MT-ND4L have undergone accelerated evolution in specific lineages, potentially indicating adaptation to different metabolic demands.

The unique ecology and physiology of Tarsius bancanus, including its nocturnal lifestyle, high energy demands for jumping locomotion, and specialized diet, may have driven specific adaptations in energy metabolism genes including MT-ND4L. Comparing these adaptations across primates can provide insights into how mitochondrial function has evolved to support diverse metabolic requirements .

How do mutations in MT-ND4L contribute to mitochondrial disorders, and how can recombinant protein studies advance our understanding?

Mutations in the MT-ND4L gene have been associated with several mitochondrial disorders, most notably Leber hereditary optic neuropathy (LHON). The T10663C (Val65Ala) mutation in human MT-ND4L has been identified in families with LHON, a condition characterized by sudden-onset vision loss due to degeneration of retinal ganglion cells and their axons .

Recombinant protein studies using systems like the Tarsius bancanus MT-ND4L can significantly advance our understanding of disease mechanisms through several approaches:

What experimental models incorporating recombinant MT-ND4L are most valuable for studying mitochondrial disease mechanisms?

Several experimental models can be developed using recombinant MT-ND4L to study mitochondrial disease mechanisms:

• Reconstituted Liposome Systems: Incorporating recombinant wild-type or mutant MT-ND4L into liposomes along with other Complex I components to study basic biophysical properties in a controlled membrane environment.

• Bacterial Expression Systems: Using bacterial hosts lacking their own Complex I for heterologous expression of recombinant MT-ND4L variants to assess functional consequences without interference from endogenous proteins.

• Mammalian Cell Culture Models: Introducing recombinant MT-ND4L into cells with depleted mitochondrial DNA (ρ0 cells) or cells with MT-ND4L mutations to assess complementation or dominant negative effects.

• iPSC-Derived Cell Types: Differentiating induced pluripotent stem cells into cell types most affected in mitochondrial diseases (e.g., neurons, retinal ganglion cells for LHON) and studying the effects of MT-ND4L variants in these disease-relevant contexts.

• Organoid Models: Developing 3D cellular models that better recapitulate tissue architecture and cell-cell interactions for studying how MT-ND4L mutations affect tissue-level function .

What spectroscopic methods are most informative for studying the electron transfer function of recombinant MT-ND4L?

• Electron Paramagnetic Resonance (EPR) Spectroscopy: This technique can monitor the redox states of iron-sulfur clusters in Complex I that are functionally connected to the proton-pumping activity supported by MT-ND4L.

• Fourier-Transform Infrared (FTIR) Spectroscopy: FTIR can detect conformational changes in proteins associated with electron transfer and proton translocation, providing insights into how MT-ND4L contributes to these processes.

• Ultraviolet-Visible (UV-Vis) Spectrophotometry: This approach can monitor NADH oxidation at 340 nm and ubiquinone reduction, offering a real-time assessment of electron transfer through Complex I containing recombinant MT-ND4L.

• Fluorescence Resonance Energy Transfer (FRET): By strategically labeling MT-ND4L and other Complex I subunits, researchers can use FRET to detect conformational changes and subunit interactions during the catalytic cycle.

• Surface-Enhanced Raman Spectroscopy (SERS): This technique can provide molecular-level insights into the interactions between MT-ND4L and other components of Complex I, particularly in membrane environments .

How can structural biology techniques be applied to study the integration of MT-ND4L within Complex I?

Understanding how MT-ND4L integrates into the larger Complex I structure is crucial for elucidating its function. Several structural biology techniques can be applied to this research question:

• Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized the structural study of large membrane protein complexes and can provide high-resolution information about MT-ND4L's position and interactions within Complex I.

• X-ray Crystallography: While challenging for membrane proteins, this approach can provide atomic-level detail of protein structure when successful.

• Nuclear Magnetic Resonance (NMR) Spectroscopy: NMR can provide valuable information about the dynamics and local structure of smaller proteins like MT-ND4L, particularly when studying isolated domains or peptide fragments.

• Cross-linking Mass Spectrometry: This approach can identify interaction points between MT-ND4L and neighboring subunits by chemically cross-linking proximal amino acids and identifying them through mass spectrometry.

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): HDX-MS can reveal regions of MT-ND4L that are exposed or protected within the Complex I structure, providing insights into its membrane topology and protein-protein interactions .

How can recombinant Tarsius bancanus MT-ND4L be utilized in comparative mitochondrial research across primate species?

Recombinant Tarsius bancanus MT-ND4L offers valuable opportunities for comparative mitochondrial research across primates through several methodological approaches:

• Functional Complementation Studies: Researchers can test whether Tarsius bancanus MT-ND4L can functionally substitute for its homologs in other species, providing insights into functional conservation and species-specific adaptations.

• Chimeric Complex I Assembly: By creating hybrid Complex I containing subunits from different primate species, researchers can identify which regions of MT-ND4L are critical for species-specific aspects of mitochondrial function.

• Comparative Biochemical Analysis: Directly comparing the enzymatic properties of Complex I reconstituted with MT-ND4L from different primate species can reveal adaptations in electron transport efficiency and proton pumping.

• Evolutionary Rate Analysis: Studying the rates of sequence evolution in MT-ND4L across primates can identify regions under different selective pressures and correlate these with functional or environmental adaptations.

• Mitochondrial-Nuclear Compatibility: Investigating how Tarsius bancanus MT-ND4L interacts with nuclear-encoded Complex I subunits from different species can provide insights into mitonuclear coevolution, a critical aspect of species adaptation and speciation .

What are the challenges and methodological solutions for expressing and purifying functional recombinant MT-ND4L?

Expressing and purifying functional recombinant MT-ND4L presents several technical challenges due to its hydrophobic nature and requirement for proper membrane integration. Researchers can overcome these obstacles through specialized approaches:

• Expression Systems:

  • Cell-Free Systems: Allow better control of the environment for membrane protein synthesis

  • Specialized Bacterial Strains: E. coli strains optimized for membrane protein expression (C41, C43)

  • Eukaryotic Expression Systems: Yeast or insect cells that provide more native-like membrane environments

• Fusion Tags and Constructs:

  • Maltose-binding protein (MBP) or SUMO tags to enhance solubility

  • Thioredoxin fusions to prevent aggregation

  • GFP fusions for monitoring expression and localization

• Purification Strategies:

  • Careful detergent selection (mild detergents like digitonin or DDM)

  • Gradient purification using specialized columns for hydrophobic proteins

  • Nanodisc or liposome incorporation to maintain native-like environment

• Refolding Protocols:

  • Step-wise dialysis methods for proper refolding if expressed as inclusion bodies

  • Lipid-assisted folding techniques

• Functional Validation:

  • Incorporation into proteoliposomes to assess membrane integration

  • Circular dichroism to confirm secondary structure

  • Activity assays as part of reconstituted Complex I .

How might studies of Tarsius bancanus MT-ND4L contribute to understanding primate adaptation to environmental challenges?

Research on Tarsius bancanus MT-ND4L can provide valuable insights into how primates adapt to specific environmental challenges through modifications in energy metabolism. Tarsiers occupy a unique ecological niche as small-bodied, nocturnal, primarily insectivorous primates with specialized adaptations including enormous eyes and extraordinary jumping capabilities that likely impose specific metabolic demands .

Future research directions might include:

• Ecological Energetics: Investigating how MT-ND4L sequence adaptations in Tarsius bancanus relate to their unique ecological niche, including their high-energy hunting strategy and nocturnal lifestyle.

• Metabolic Rate Correlations: Comparing MT-ND4L sequence variations across primates with different metabolic rates and activity patterns to identify potential adaptations for energy efficiency or capacity.

• Climate Adaptation Studies: Examining whether MT-ND4L shows adaptations related to thermal regulation, as mitochondrial function is temperature-sensitive and critical for thermogenesis.

• Dietary Adaptation Research: Investigating whether the specialized insectivorous diet of tarsiers has driven specific adaptations in mitochondrial genes including MT-ND4L.

• Altitude Adaptation Analysis: Comparing MT-ND4L in tarsier populations from different elevations to identify potential adaptations to oxygen availability, since Complex I function is oxygen-dependent .

What emerging technologies might enhance research applications of recombinant MT-ND4L in the near future?

Several emerging technologies hold promise for advancing research with recombinant MT-ND4L:

• CRISPR/Cas9 Mitochondrial Editing: Though challenging due to the unique properties of mitochondrial genetics, advances in mitochondrial genome editing may soon allow precise manipulation of MT-ND4L in living cells.

• Nanoscale Imaging Technologies: Techniques like super-resolution microscopy and atomic force microscopy are continuously improving and may soon allow visualization of individual Complex I components including MT-ND4L within native membrane environments.

• Artificial Intelligence for Protein Structure Prediction: Tools like AlphaFold are revolutionizing protein structure prediction, which could enhance our understanding of MT-ND4L structure without requiring crystallization.

• Organ-on-a-Chip Technology: These systems can create more physiologically relevant environments for studying MT-ND4L function in tissue-specific contexts relevant to mitochondrial diseases.

• Single-Molecule Techniques: Advances in single-molecule fluorescence and force spectroscopy may soon allow direct observation of conformational changes in individual Complex I molecules during catalysis, providing unprecedented insights into how MT-ND4L contributes to energy transduction .