Recombinant Tarsius syrichta NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. Specify your desired tag type in advance for preferential development.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Tarsius syrichta (Philippine tarsier)
Target Names
Target Protein Sequence
SFIGATTLMIAHGLTSSLLFCLANTNYERVHSRTMALARGLQTLLPLAATWWLLASLTNL ALPPTINLIGELSVMMAAFSWSHLTIILVGLNTLITALYSLYMLIMTQRGKYTYHINNIM PPFTRENTLMIMHLFPLILLSTNPKLIMGTMYCKYSLNKTLDCESNN
Uniprot No.

Target Background

Function
Recombinant Tarsius syrichta NADH-ubiquinone oxidoreductase chain 4 (MT-ND4) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is MT-ND4 and what is its function in mitochondrial respiration?

    MT-ND4 (NADH-ubiquinone oxidoreductase chain 4) is a mitochondrial DNA-encoded subunit of Complex I in the respiratory chain. It plays a crucial role in electron transfer from NADH to ubiquinone and contributes to proton pumping across the inner mitochondrial membrane.

    Functionally, MT-ND4 is involved in:

    • NADH oxidation and ubiquinone reduction

    • Proton translocation across the inner mitochondrial membrane

    • Energy conservation as part of the oxidative phosphorylation system

    Mammalian mitochondrial Complex I consists of 45 subunits, including 7 mtDNA-encoded subunits (ND1, ND2, ND3, ND4, ND5, ND6, and ND4L). These mitochondrial-encoded components are integral to the membrane domain of the complex and are directly involved in proton pumping .

  • What is the evolutionary significance of studying MT-ND4 from Tarsius syrichta?

    Studying MT-ND4 from the Philippine tarsier (Tarsius syrichta) has significant evolutionary implications:

    • Tarsiers occupy a unique phylogenetic position within primates, with ongoing debate about whether they should be grouped with strepsirrhine primates in a prosimian clade or with anthropoids in a haplorrhine clade

    • Genomic analysis involving 1.26 million base pair alignments from 1078 orthologous genes provides strong support for tarsiers belonging to the haplorrhine clade

    • MT-ND4 and other mitochondrial genes (12S, CytB, ND2) have been used for phylogeographic analysis of Tarsius syrichta lineages

    • Conservation genetics studies of Philippine tarsiers have revealed distinct evolutionary lineages within the species based in part on mitochondrial gene analysis

    Mitochondrial gene comparisons provide valuable data for resolving deep nodes in primate phylogeny, with divergence estimates suggesting evolutionary timescales for the separation of different primate lineages .

  • How can recombinant MT-ND4 be properly stored and handled?

    Proper storage and handling of recombinant MT-ND4 protein is crucial for maintaining its stability and functionality:

    Storage Conditions:

    • Store at -20°C for regular storage

    • For extended storage, conserve at -20°C or -80°C

    • Working aliquots can be stored at 4°C for up to one week

    Buffer Composition:

    • Typically supplied in Tris-based buffer with 50% glycerol optimized for the protein

    Handling Recommendations:

    • Avoid repeated freezing and thawing cycles

    • Prepare small working aliquots to minimize freeze-thaw events

    • When designing experiments, consider the stability profile of the protein under various experimental conditions

    Experimental Considerations:

    • When incorporating the recombinant protein into functional assays, consider the presence of the tag (which is determined during the production process)

    • The protein's activity can be significantly affected by the absence of phospholipids, as observed in other NADH:ubiquinone oxidoreductase complexes

Advanced Research Questions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.