Recombinant Tatera robusta Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Gerbilliscus robustus (Fringe-tailed gerbil) (Tatera robusta)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYLISLMLSTKLIHTSTMDAQE VETIWTILPAIILIMIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTNELKPGELRLLEVDNRVILPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVMSNRPGIFYGQCSEICGSNHSFMPIVLEMIPLKLFENWSISMS
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprised of Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Specifically, MT-CO2 plays a crucial role in cytochrome c oxidase's catalytic reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, composed of heme a3 and CuB, ultimately reduces molecular oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Tatera robusta Cytochrome c oxidase subunit 2 and what is its biological function?

Tatera robusta Cytochrome c oxidase subunit 2 (MT-CO2) is a protein component of the cytochrome c oxidase complex, the terminal enzyme in the mitochondrial electron transport chain. According to protein sequence data, it has 227 amino acids with UniProt accession number Q38S56 . MT-CO2 plays a crucial role in cellular respiration by facilitating electron transfer from cytochrome c to the catalytic center of the oxidase complex.

Functionally, cytochrome c oxidase subunit 2 transfers electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 . This electron transfer is part of the biochemical process that reduces oxygen to water, representing the final step in the respiratory chain. The protein is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is crucial for ATP production during cellular respiration .

How is recombinant Tatera robusta MT-CO2 typically produced and stored?

Recombinant Tatera robusta MT-CO2 is typically produced using bacterial expression systems. Based on production methods for similar proteins, the standard protocol involves:

  • Gene synthesis or cloning of the MT-CO2 coding sequence

  • Insertion into an expression vector with an appropriate tag (commonly histidine)

  • Transformation into bacterial hosts such as E. coli

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein purification via affinity chromatography

  • Quality control testing including SDS-PAGE verification (typically >90% purity)

  • Lyophilization or buffer preparation for storage

For optimal storage, recombinant MT-CO2 should be kept at -20°C or -80°C for long-term storage, while working aliquots can be maintained at 4°C for up to one week . The protein is typically supplied either as a lyophilized powder or in a buffer containing 50% glycerol optimized for stability . Importantly, repeated freezing and thawing should be avoided to maintain protein integrity and function .

What experimental approaches can be used to assess the electron transfer activity of recombinant MT-CO2?

Assessing the electron transfer activity of recombinant MT-CO2 requires specialized techniques that can measure its ability to transfer electrons within the respiratory chain. The following methodological approaches are recommended:

  • Spectroscopic Methods:

    • UV-visible spectroscopy to monitor changes in cytochrome c oxidation states

    • Stopped-flow spectroscopy to measure electron transfer kinetics

    • Electron paramagnetic resonance (EPR) to analyze the copper center's redox state

  • Electrochemical Techniques:

    • Cyclic voltammetry to determine redox potentials

    • Bioelectrochemical systems to measure current responses, similar to those used in bacterial electron transfer studies

    • Chronoamperometry to quantify electron transfer rates

  • Oxygen Consumption Analysis:

    • High-resolution respirometry to detect changes in oxygen reduction

    • Clark-type oxygen electrode measurements to determine catalytic activity

    • Correlation of oxygen consumption with electron transfer efficiency

These methods should be used complementarily to obtain a comprehensive profile of the protein's electron transfer capabilities, especially when comparing wild-type and mutant variants or cross-species functional analyses.

How can species-specific variations in MT-CO2 be utilized for evolutionary biology research?

The cytochrome c oxidase subunit 2 gene (COII) provides valuable insights for evolutionary biology research due to its combination of conserved functional domains and variable regions. Based on established methodologies, researchers can implement the following approaches:

  • Selective Pressure Analysis:

    • Estimate the ratio of nonsynonymous to synonymous substitution rates (ω) using maximum likelihood models

    • Identify sites under purifying selection (ω << 1), neutral evolution (ω = 1), or positive selection (ω > 1)

    • Studies have shown that while most COII codons are under strong purifying selection, approximately 4% of sites evolve under relaxed selective constraint

  • Co-evolutionary Dynamics:

    • Analyze compensatory mutations between MT-CO2 and interacting nuclear-encoded proteins

    • Investigate mitonuclear compatibility in hybrid systems

    • Previous research has identified that some codons in COII appear to be under positive selection to compensate for amino acid substitutions in other interacting subunits

  • Phylogenetic Applications:

    • Use MT-CO2 sequence data to construct species and population-level phylogenies

    • Compare with nuclear gene phylogenies to identify discordance patterns

    • In some species, interpopulation divergence at the COII locus can reach nearly 20% at the nucleotide level, including numerous nonsynonymous substitutions

  • Experimental Verification:

    • Express recombinant MT-CO2 from different species or populations

    • Conduct functional assays to correlate sequence differences with biochemical properties

    • Examine fitness consequences in hybrid systems with mismatched mitonuclear components

This multifaceted approach allows researchers to connect molecular variations in MT-CO2 with functional consequences and evolutionary adaptations.

What challenges exist in expressing functional recombinant MT-CO2 in heterologous systems?

Expressing functional recombinant MT-CO2 poses several challenges that researchers must address through methodological optimization:

  • Membrane Protein Integration Issues:

    • MT-CO2 contains hydrophobic transmembrane domains

    • Bacterial membranes differ significantly from mitochondrial membranes

    • Poor membrane integration can lead to protein misfolding and aggregation

  • Cofactor Incorporation:

    • Proper loading of copper ions is essential for electron transfer function

    • Heterologous systems may lack appropriate machinery for metal cofactor insertion

    • Supplementation with copper and optimization of redox conditions may be necessary

  • Protein Folding and Solubility:

    • Recombinant MT-CO2 is often supplied as lyophilized powder due to solubility challenges

    • Expression conditions must be carefully optimized to prevent inclusion body formation

    • Specialized solubilization and refolding protocols may be required

  • Post-translational Modifications:

    • Bacterial systems lack many eukaryotic post-translational modification pathways

    • Absence of specific modifications may affect protein function

    • Expression in eukaryotic systems might better preserve native modification patterns

To address these challenges, researchers should consider:

  • Using specialized expression hosts designed for membrane proteins

  • Co-expression with chaperones and assembly factors

  • Employing fusion partners to enhance solubility

  • Developing detailed purification protocols that maintain protein integrity and function

How can site-directed mutagenesis of recombinant MT-CO2 enhance our understanding of electron transfer mechanisms?

Site-directed mutagenesis of recombinant Tatera robusta MT-CO2 provides a powerful approach to dissect electron transfer mechanisms by systematically altering specific amino acid residues. A comprehensive mutagenesis strategy should include:

  • Target Selection Based on Structural and Evolutionary Data:

    • Conserved residues in copper-binding domains

    • Amino acids at the interface with cytochrome c

    • Residues identified as being under selection pressure in evolutionary studies

    • Amino acids forming putative electron transfer pathways

  • Systematic Mutation Types:

    • Conservative substitutions to probe the importance of specific chemical properties

    • Charge alterations to investigate electrostatic contributions

    • Cysteine scanning to identify structurally important regions

    • Creation of chimeric constructs with segments from different species

  • Comprehensive Functional Assessment:

    • Spectroscopic characterization of copper binding in mutant proteins

    • Determination of electron transfer rates using methods described in section 2.1

    • Protein-protein interaction studies with cytochrome c and other subunits

    • Integration capabilities into functional cytochrome c oxidase complexes

This approach has successfully identified functionally critical residues in related systems. For example, specific sites in Tigriopus californicus COII were found to have experienced positive selection within certain population clades, with functional consequences for interpopulation hybrids .

What potential applications exist for recombinant Tatera robusta MT-CO2 in bioenergetic research?

Recombinant Tatera robusta MT-CO2 offers several unique applications in bioenergetic research:

  • Construction of Synthetic Electron Transport Systems:

    • Integration into artificial membrane systems for controlled electron transfer studies

    • Creation of minimal functional units to study fundamental bioenergetic principles

    • Development of hybrid systems with components from different species to investigate compatibility

  • Bioelectrochemical Applications:

    • Development of bioelectrodes incorporating MT-CO2 for biosensing applications

    • Creation of biofuel cells based on respiratory chain components

    • Studies have demonstrated light-dependent electron transfer in microbial systems that could inform MT-CO2 applications in bioelectrochemistry

  • Comparative Bioenergetics:

    • Analysis of species-specific adaptations in electron transfer efficiency

    • Investigation of environmental adaptations in mitochondrial function

    • Correlation of sequence variations with functional differences across species

  • Pharmaceutical Research:

    • Screening platform for compounds that modulate cytochrome c oxidase activity

    • Investigation of species-specific inhibitor effects

    • Some drugs, such as Talmapimod, have been identified as targeting cytochrome c oxidase subunits

These applications leverage the unique properties of Tatera robusta MT-CO2 while contributing to our broader understanding of bioenergetic systems and potential biotechnological applications.

What techniques can be used to assess the interaction between recombinant MT-CO2 and cytochrome c?

Characterizing the interaction between recombinant MT-CO2 and cytochrome c is essential for understanding electron transfer mechanisms. The following methodological approaches provide complementary information:

  • Binding Affinity Determination:

    • Surface Plasmon Resonance (SPR) to measure real-time binding kinetics

    • Isothermal Titration Calorimetry (ITC) to determine thermodynamic parameters

    • Microscale Thermophoresis (MST) for measurements in near-native conditions

    • Biolayer Interferometry (BLI) for label-free detection of protein-protein interactions

  • Structural Characterization:

    • Chemical cross-linking followed by mass spectrometry to identify binding interfaces

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Computational docking validated by experimental constraints

  • Functional Analysis:

    • Electron transfer rate measurements using spectroscopic methods

    • Correlation of binding affinity with electron transfer efficiency

    • Mutagenesis studies targeting the interface between the proteins

These approaches can reveal how species-specific variations in MT-CO2 sequence affect interaction with cytochrome c, potentially explaining differences in respiratory efficiency or environmental adaptations across species.

How can recombinant MT-CO2 be incorporated into functional cytochrome c oxidase complexes in vitro?

Reconstituting functional cytochrome c oxidase complexes with recombinant MT-CO2 requires a systematic approach addressing the multisubunit nature of the complex and proper assembly of cofactors:

  • Component Preparation:

    • Express and purify recombinant MT-CO2 with appropriate tags

    • Source or express other essential subunits (particularly subunits 1 and 3)

    • Ensure proper folding of individual components

  • Membrane Mimetic Systems:

    • Prepare liposomes with an appropriate lipid composition

    • Alternatively, use nanodiscs as controlled membrane scaffolds

    • Optimize lipid composition to facilitate protein integration

  • Assembly Protocol:

    • Mix purified subunits in stoichiometric ratios

    • Add necessary cofactors (copper ions and heme groups)

    • Include assembly factors if required

    • Allow sufficient time for complex formation under controlled conditions

  • Functional Validation:

    • Spectroscopic analysis to confirm proper cofactor incorporation

    • Oxygen consumption assays to verify catalytic activity

    • Electron transfer measurements to assess functional efficiency

    • Comparison with native enzyme complexes

This methodological approach enables the creation of functional cytochrome c oxidase complexes incorporating recombinant Tatera robusta MT-CO2, providing a platform for detailed mechanistic studies and comparative analyses across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.