Recombinant Taterillus emini Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Taterillus emini (Emin's gerbil)
Target Names
Target Protein Sequence
MAYPLQLGLQDASSPIMEELMNFHDHTLMIVFLISSLVLYLISLMLTTKLIHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDFEDLSFDS YMIPTNELKPGELRQLEVDNRMVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGVFYGQCSEICGSNHSFMPIVLEMIPLKLFENWSLSLT
Uniprot No.

Target Background

Function
Recombinant *Taterillus emini* Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme is crucial for oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes work together to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. The BNC, comprising heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Taterillus emini Cytochrome c Oxidase Subunit 2?

Recombinant Taterillus emini Cytochrome c Oxidase Subunit 2 (MT-CO2) is a laboratory-synthesized version of the natural mitochondrial protein found in the rodent species Taterillus emini. This protein functions as a critical component of the respiratory electron transport chain, specifically in Complex IV (cytochrome c oxidase). The recombinant protein is produced through expression in heterologous systems to enable detailed biochemical and structural studies without the need to extract the protein directly from animal tissues. The recombinant form maintains the same amino acid sequence as the native protein but may have additional tags or modifications to facilitate purification and characterization .

How does MT-CO2 from Taterillus emini differ from MT-CO2 in other species?

MT-CO2 from Taterillus emini exhibits species-specific variations in amino acid sequence compared to other mammals, while maintaining the core functional domains necessary for electron transport. These variations can be particularly valuable for evolutionary studies and comparative biochemistry. Researchers often use sequence alignment tools to identify conserved regions across species, which can provide insights into essential functional domains versus regions that allow evolutionary flexibility. When designing experiments involving this protein, researchers should consider these species-specific characteristics, especially when making cross-species comparisons or developing antibodies targeting specific epitopes .

What is the role of MT-CO2 in mitochondrial function?

MT-CO2 serves as a crucial subunit in cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This complex catalyzes the reduction of molecular oxygen to water while pumping protons across the inner mitochondrial membrane, contributing to the electrochemical gradient that drives ATP synthesis. The MT-CO2 subunit specifically contains copper centers that participate in electron transfer reactions. Dysfunction in this protein has been associated with various metabolic disorders, making it an important target for understanding cellular energetics and mitochondrial diseases .

What expression systems are most effective for producing Recombinant Taterillus emini MT-CO2?

For optimal expression of functional Recombinant Taterillus emini MT-CO2, researchers should consider several expression systems based on experimental goals:

Expression SystemAdvantagesLimitationsYield Potential
E. coliRapid growth, low cost, high yieldPotential improper folding of mammalian proteins, lack of post-translational modificationsMedium (0.5-5 mg/L)
Insect cells (Baculovirus)Better folding, some post-translational modificationsHigher cost, longer production timeHigh (2-10 mg/L)
Mammalian cells (HEK293, CHO)Native-like folding and modificationsHighest cost, complex protocols, slow growthLow-Medium (0.1-2 mg/L)
Yeast (P. pastoris)Good for membrane proteins, inducible expressionMedium complexity, different glycosylation patternsMedium-High (1-8 mg/L)

The choice depends on research requirements; mammalian systems are recommended when studying interactions with other mammalian proteins or when post-translational modifications are crucial for function .

What purification strategies yield the highest purity of functional MT-CO2?

Purification of Recombinant Taterillus emini MT-CO2 requires a multi-step approach:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using His-tagged constructs or custom affinity chromatography with specific antibodies.

  • Intermediate Purification: Ion exchange chromatography based on the protein's isoelectric point (typically anion exchange at pH 8.0).

  • Polishing: Size exclusion chromatography to remove aggregates and ensure homogeneity.

For membrane-associated forms of MT-CO2, detergent selection is critical. A combination of mild detergents such as DDM (n-Dodecyl β-D-maltoside) at 0.1-0.5% during extraction, followed by lower concentrations (0.01-0.05%) during purification, helps maintain protein stability while removing excess detergent. Researchers should validate purification success using SDS-PAGE, Western blotting, and activity assays to confirm both purity and functionality .

How should researchers validate the structural integrity of purified MT-CO2?

Comprehensive validation of Recombinant Taterillus emini MT-CO2 structural integrity requires multiple analytical approaches:

  • Circular Dichroism (CD) Spectroscopy: Analyze secondary structure elements with far-UV CD (190-250 nm) to confirm proper folding.

  • Thermal Shift Assays: Determine protein stability through melt curves using differential scanning fluorimetry.

  • Limited Proteolysis: Compare digestion patterns of recombinant versus native protein to assess structural similarity.

  • Mass Spectrometry: Confirm amino acid sequence and post-translational modifications using LC-MS/MS.

  • Analytical Ultracentrifugation: Assess oligomeric state and homogeneity in solution.

The gold standard remains functional assays measuring electron transfer activity using reduced cytochrome c as substrate. Activity comparable to native protein (within 80-100% range) strongly indicates proper structural conformation .

How can Recombinant Taterillus emini MT-CO2 be used in evolutionary biology studies?

Recombinant Taterillus emini MT-CO2 serves as a valuable tool in evolutionary biology research through several approaches:

  • Phylogenetic Analysis: Comparing MT-CO2 sequences from Taterillus emini with other rodent species helps reconstruct evolutionary relationships and divergence times. The mitochondrial cytochrome c oxidase genes evolve at rates useful for examining relatively recent evolutionary events.

  • Selection Pressure Analysis: Using software like PAML or HyPhy to calculate Ka/Ks ratios across different domains of MT-CO2 reveals regions under positive selection versus conserved functional domains.

  • Functional Comparative Studies: Expressing recombinant MT-CO2 from multiple related species allows direct comparison of biochemical properties, including:

    • Oxygen affinity differences

    • Electron transfer rates

    • Thermal stability profiles

    • pH response curves

  • Ancestral Sequence Reconstruction: Working backward from contemporary sequences to synthesize proteins that may have existed in evolutionary ancestors, providing insights into functional evolution of mitochondrial respiration.

These approaches collectively illuminate how environmental pressures and ecological adaptations have shaped the evolution of energy metabolism in different rodent lineages .

What are the methodological considerations for using MT-CO2 in studies of mitochondrial dysfunction?

When employing Recombinant Taterillus emini MT-CO2 in mitochondrial dysfunction studies, researchers should implement the following methodological framework:

  • Complementation Studies:

    • Introduce recombinant MT-CO2 into cytochrome c oxidase-deficient cell lines

    • Measure restoration of mitochondrial function through oxygen consumption rate (OCR) measurements

    • Compare with wild-type controls using Seahorse XF or Clark electrode-based methods

  • Mutational Analysis:

    • Generate site-directed mutants mimicking naturally occurring variations or disease-causing mutations

    • Quantify effects on enzyme kinetics using stopped-flow spectrophotometry

    • Determine changes in Km, Vmax, and catalytic efficiency (kcat/Km)

  • Interaction Studies:

    • Map protein-protein interactions within the respiratory complex using techniques such as:

      • Crosslinking mass spectrometry (XL-MS)

      • Blue native PAGE

      • Co-immunoprecipitation with other complex IV subunits

  • Inhibitor Studies:

    • Determine IC50 values for known complex IV inhibitors

    • Compare inhibition profiles between species to identify structural or functional differences

Accurate normalization to protein content and appropriate statistical analysis (typically ANOVA with post-hoc tests) are essential for meaningful interpretation of results .

How can researchers develop assays to measure MT-CO2 activity in complex biological samples?

Developing robust assays for measuring MT-CO2 activity in complex biological samples requires careful consideration of specificity, sensitivity, and reproducibility. A comprehensive approach includes:

  • Spectrophotometric Cytochrome c Oxidation Assay:

    • Monitor the oxidation of reduced cytochrome c at 550 nm

    • Use specific inhibitors (e.g., potassium cyanide) as negative controls

    • Calculate activity as the first-order rate constant (k) per unit protein

  • Polarographic Oxygen Consumption:

    • Measure oxygen uptake using Clark-type electrodes

    • Calculate respiratory control ratios in the presence of substrates and inhibitors

    • Compare Taterillus emini MT-CO2 with other species' variants

  • In-gel Activity Staining:

    • Separate mitochondrial complexes using blue native PAGE

    • Visualize complex IV activity with 3,3'-diaminobenzidine tetrahydrochloride

    • Quantify band intensity using densitometry

  • Immunocapture-based Activity Assays:

    • Isolate complex IV using antibodies against MT-CO2

    • Measure activity in the immunoprecipitated fraction

    • Normalize to complex IV content using Western blotting

The assay selection should be guided by sample type, with cellular samples typically requiring polarographic methods, while purified proteins are better assessed using spectrophotometric approaches .

What structural characterization techniques are most informative for MT-CO2 research?

Structural characterization of Recombinant Taterillus emini MT-CO2 requires a multi-faceted approach integrating several complementary techniques:

  • X-ray Crystallography: Provides atomic-level resolution (typically 1.5-3.0 Å) of protein structure, revealing precise positions of amino acid residues and cofactors. Crystallization conditions generally require:

    • Protein concentration: 5-15 mg/mL

    • Detergent: 0.01-0.05% DDM or other mild detergents

    • Screening: 500-1000 initial conditions

    • Optimization: Fine-tuning pH (typically 6.5-8.0), salt concentration, and precipitants

  • Cryo-Electron Microscopy (Cryo-EM): Particularly valuable for visualizing MT-CO2 within the entire cytochrome c oxidase complex, preserving the native membrane environment and revealing dynamic states.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: While challenging for the entire protein due to size limitations, NMR can be invaluable for analyzing specific domains or interaction sites using isotopically labeled (15N, 13C) protein fragments.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Provides insights into protein dynamics and solvent accessibility, complementing static structural techniques by revealing flexible regions and conformational changes upon binding interactions.

The integration of these techniques has revealed that MT-CO2 contains multiple transmembrane helices and extramembrane domains housing metal-binding sites crucial for electron transfer .

How should researchers approach studying interactions between MT-CO2 and other proteins in the respiratory chain?

Investigating interactions between Recombinant Taterillus emini MT-CO2 and other respiratory chain components requires a systematic approach incorporating multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP) Studies:

    • Use anti-MT-CO2 antibodies to pull down associated proteins

    • Confirm interactions by reciprocal Co-IP with antibodies against potential partners

    • Analyze precipitated complexes using Western blotting or mass spectrometry

  • Proximity Labeling Approaches:

    • Generate BioID or APEX2 fusion constructs with MT-CO2

    • Express in appropriate cell lines or reconstituted systems

    • Identify labeled proteins through streptavidin purification and mass spectrometry

  • Surface Plasmon Resonance (SPR) Kinetics:

    • Immobilize purified MT-CO2 on sensor chips

    • Measure binding kinetics with purified interaction partners

    • Determine association (kon) and dissociation (koff) rate constants

  • Microscale Thermophoresis (MST):

    • Quantify binding affinities in solution

    • Particularly valuable for membrane protein interactions

    • Calculate dissociation constants (Kd) under various conditions

  • Cross-linking Mass Spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers (e.g., DSS, BS3)

    • Identify specific interaction interfaces through MS/MS analysis

    • Map crosslinked residues onto structural models

These methods should be performed under conditions that preserve the native membrane environment when possible, such as using nanodiscs or detergent micelles that maintain protein structure and function .

What are the challenges in determining the structure-function relationship of MT-CO2 compared to other cytochrome c oxidase subunits?

Determining the structure-function relationship of Recombinant Taterillus emini MT-CO2 presents several unique challenges compared to other cytochrome c oxidase subunits:

  • Membrane Protein Complexities:

    • MT-CO2 contains multiple transmembrane domains, making crystallization and structural determination technically challenging

    • Detergent selection is critical, as inappropriate choices can disrupt native interactions

    • The hydrophobic nature of membrane regions complicates expression and purification

  • Dynamic Interactions:

    • MT-CO2 undergoes conformational changes during the catalytic cycle

    • These dynamic states are difficult to capture with static structural methods

    • Multiple structural snapshots are needed to fully understand function

  • Cooperative Function:

    • MT-CO2 functions only in context with other subunits

    • Isolating its specific contribution to catalysis requires sophisticated mutagenesis approaches

    • Distinguishing direct vs. allosteric effects on enzyme activity presents analytical challenges

  • Metal Coordination:

    • MT-CO2 contains metal-binding sites critical for function

    • Metal incorporation during recombinant expression may be incomplete

    • Spectroscopic methods (EPR, XAS) are needed to characterize metal centers properly

Researchers address these challenges through integrated approaches combining mutagenesis, spectroscopy, and computational modeling. Site-directed mutations targeting conserved residues, followed by activity assays and structural analysis, help map functional domains and establish mechanistic insights into electron transfer pathways .

What are common pitfalls in experimental design when working with MT-CO2, and how can they be avoided?

Researchers working with Recombinant Taterillus emini MT-CO2 frequently encounter several experimental challenges that can compromise results. Here are common pitfalls and recommended solutions:

  • Protein Instability and Aggregation:

    • Pitfall: Rapid loss of activity during purification and storage.

    • Solution: Incorporate stabilizing agents (5-10% glycerol, 1 mM DTT) in all buffers. Store at -80°C in small aliquots to avoid freeze-thaw cycles. Consider adding specific lipids (0.01-0.05 mg/ml cardiolipin) to mimic the native membrane environment.

  • Incomplete Incorporation of Metal Cofactors:

    • Pitfall: Reduced enzymatic activity due to missing copper atoms in recombinant protein.

    • Solution: Supplement expression media with 10-50 µM CuSO₄ and include 1-5 µM CuSO₄ in purification buffers. Verify metal content using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS).

  • Misleading Activity Measurements:

    • Pitfall: Background oxidation of cytochrome c giving false positive results.

    • Solution: Always include appropriate controls (heat-inactivated enzyme, specific inhibitors like KCN at 1 mM). Perform measurements in the presence of superoxide dismutase (5-10 U/mL) to prevent auto-oxidation.

  • Detergent Interference:

    • Pitfall: Excessive detergent causing protein denaturation or assay interference.

    • Solution: Optimize detergent concentration using activity assays. Typically maintain detergent just above critical micelle concentration (CMC) during purification, then reduce to 1-2× CMC for storage and assays.

Careful validation of each experimental step with appropriate controls is essential for generating reliable data with this complex membrane protein .

How can researchers address data inconsistencies when comparing MT-CO2 activity across different experimental conditions?

Addressing data inconsistencies when working with Recombinant Taterillus emini MT-CO2 requires a systematic approach to identify and control variables affecting protein activity. Researchers should implement the following strategy:

What bioinformatic tools are most valuable for analyzing MT-CO2 sequence and structural data?

For comprehensive analysis of Recombinant Taterillus emini MT-CO2, researchers should employ a suite of complementary bioinformatic tools tailored to different analytical needs:

  • Sequence Analysis Tools:

    • MEGA X: Phylogenetic analysis and evolutionary rate calculation

    • PAML: Detection of positive selection and evolutionary constraint

    • ConSurf: Identification of functionally important residues based on evolutionary conservation

    • MUSCLE/CLUSTAL: Multiple sequence alignment across species

  • Structural Prediction and Analysis:

    • AlphaFold2/RoseTTAFold: Accurate 3D structure prediction, particularly valuable for regions lacking experimental structures

    • SWISS-MODEL: Homology modeling based on known cytochrome c oxidase structures

    • PyMOL/Chimera: Visualization and analysis of structural features

    • PredictProtein: Secondary structure and solvent accessibility prediction

  • Functional Annotation Tools:

    • InterProScan: Identification of functional domains and motifs

    • KEGG Pathway: Integration with metabolic and signaling pathways

    • STRING: Protein-protein interaction network analysis

    • SNPs3D: Prediction of functional effects of mutations

  • Molecular Dynamics and Docking Tools:

    • GROMACS: Simulation of protein dynamics in membrane environments

    • HADDOCK: Modeling of protein-protein interactions

    • AutoDock: Analysis of small molecule binding sites

The integration of these tools enables researchers to move from sequence to structure to function, providing a comprehensive understanding of MT-CO2 in both evolutionary and mechanistic contexts. For membrane protein-specific analyses, specialized tools like TMHMM for transmembrane helix prediction and PPM server for membrane orientation are particularly valuable .

How can MT-CO2 research contribute to our understanding of mitochondrial diseases?

Recombinant Taterillus emini MT-CO2 research offers several pathways to enhance our understanding of mitochondrial diseases:

  • Comparative Models for Human Pathogenic Mutations:

    • By introducing equivalent mutations to those found in human MT-CO2-related disorders into the Taterillus emini protein, researchers can develop model systems for studying disease mechanisms.

    • This approach enables characterization of biochemical consequences without the ethical and practical limitations of human samples.

    • The evolutionary distance provides insights into conserved pathological mechanisms versus species-specific effects.

  • Functional Rescue Strategies:

    • Chimeric proteins combining domains from Taterillus emini MT-CO2 with human sequences can be tested for their ability to rescue cytochrome c oxidase deficiency in cellular models.

    • These experiments help identify critical functional domains that could be targets for therapeutic interventions.

    • Successful rescue strategies can inform gene therapy approaches for mitochondrial disorders.

  • Biophysical Characterization of Enzymatic Defects:

    • The recombinant nature of the protein allows precise measurement of how specific mutations affect:

      • Electron transfer rates

      • Proton pumping efficiency

      • Oxygen affinity

      • Assembly into the complete cytochrome c oxidase complex

    • These measurements can elucidate the mechanistic basis of disease pathology.

  • Drug Screening Platforms:

    • Purified recombinant MT-CO2 incorporated into activity assays provides a platform for screening compounds that might enhance or restore function in mutated proteins.

    • Structure-based drug design targeting specific domains identified through comparative studies.

This research contributes to a deeper understanding of both basic mitochondrial biology and pathophysiological mechanisms in cytochrome c oxidase deficiency disorders .

What methodologies enable the study of MT-CO2 post-translational modifications?

Studying post-translational modifications (PTMs) of Recombinant Taterillus emini MT-CO2 requires sophisticated analytical approaches:

  • Mass Spectrometry-Based PTM Mapping:

    • Sample Preparation: Optimized digestion protocols using multiple proteases (trypsin, chymotrypsin, AspN) to maximize sequence coverage.

    • Enrichment Strategies:

      • Phosphopeptide enrichment: TiO₂ or IMAC (Fe³⁺) chromatography

      • Glycopeptide enrichment: Lectin affinity chromatography

      • Acetylated peptide enrichment: Anti-acetyllysine antibodies

    • Detection Methods:

      • High-resolution MS/MS (Orbitrap or Q-TOF)

      • Electron transfer dissociation (ETD) for preserving labile modifications

      • Parallel reaction monitoring (PRM) for targeted quantification

  • Site-Specific Modification Analysis:

    • Generate site-directed mutants (Ser/Thr→Ala for phosphorylation sites)

    • Perform comparative activity assays between wild-type and mutant proteins

    • Use phosphomimetic mutations (Ser/Thr→Asp/Glu) to simulate constitutive phosphorylation

  • Dynamic PTM Monitoring:

    • Pulse-chase experiments with isotopically labeled precursors

    • Time-resolved analysis following stimulation or stress conditions

    • Correlation of modification states with enzymatic activity

  • PTM Crosstalk Investigation:

    • Multi-modification analysis to detect interdependence of different PTMs

    • Sequential immunoprecipitation using antibodies against different modifications

    • Computational modeling of PTM networks and their effects on protein structure

These methodologies reveal how post-translational modifications regulate MT-CO2 function, stability, and interactions within the respiratory complex, providing insights into dynamic regulation of mitochondrial function .

How can researchers utilize MT-CO2 in synthetic biology applications?

Recombinant Taterillus emini MT-CO2 offers unique opportunities for synthetic biology applications through several innovative approaches:

  • Engineered Respiratory Complexes:

    • Create chimeric cytochrome c oxidase complexes with subunits from different species to optimize properties such as:

      • Oxygen affinity (potentially enhancing function under hypoxic conditions)

      • Temperature stability (for biotechnological applications requiring thermostable variants)

      • Resistance to inhibitors (developing variants less susceptible to environmental toxins)

    • These engineered complexes can be expressed in bacterial or yeast systems for industrial applications.

  • Biosensor Development:

    • Exploit the oxygen-binding properties of MT-CO2 to create biosensors for:

      • Oxygen concentration in bioreactors

      • Cellular respiration monitoring in real-time

      • Detection of cytochrome c oxidase inhibitors in environmental samples

    • Coupling with reporter systems (fluorescent proteins or electrochemical detection) enables quantitative measurements.

  • Minimal Respiratory Systems:

    • Determine the minimal component set needed for functional electron transport

    • Reconstitute simplified respiratory chains in artificial membrane systems

    • Create basic models of energy transduction for educational and research purposes

  • Protein Engineering Applications:

    • Use directed evolution approaches to generate MT-CO2 variants with enhanced properties:

      • Improved catalytic efficiency (kcat/Km)

      • Greater stability in non-native environments

      • Novel substrate specificities

    • Apply computational design to predict mutations that might confer desired properties

These synthetic biology applications not only advance our fundamental understanding of respiratory chain function but also create opportunities for biotechnological innovations in bioenergy, bioremediation, and biosensing fields .

What emerging technologies are likely to advance MT-CO2 research in the next decade?

The future of Recombinant Taterillus emini MT-CO2 research will be shaped by several cutting-edge technologies that promise to overcome current limitations and open new research avenues:

  • Cryo-Electron Tomography (Cryo-ET) will enable visualization of MT-CO2 within intact mitochondrial membranes, providing unprecedented insights into its native organization and interactions with other respiratory complexes.

  • Single-Molecule Techniques including FRET and force spectroscopy will reveal the dynamic conformational changes associated with electron transfer and proton pumping, capturing transient states previously inaccessible to bulk measurements.

  • AI-Driven Structural Prediction through platforms like AlphaFold will continue to improve, allowing accurate modeling of protein-protein interactions and predicting the effects of mutations with greater precision.

  • Organoid and Microphysiological Systems will provide more physiologically relevant experimental platforms compared to traditional cell cultures, enabling the study of MT-CO2 function in tissue-specific contexts.

  • CRISPR-Based Manipulation technologies will facilitate precise genomic editing of MT-CO2 in various model organisms, creating better disease models and enabling in vivo functional studies.

These technological advances will collectively enhance our understanding of MT-CO2's role in cellular energetics, disease pathology, and evolutionary adaptations, paving the way for novel therapeutic strategies targeting mitochondrial dysfunction .

What are the most pressing unanswered questions regarding MT-CO2 function and regulation?

Despite significant advances, several critical questions about Recombinant Taterillus emini MT-CO2 remain unanswered and represent important research frontiers:

  • Regulatory Mechanisms:

    • How is MT-CO2 activity modulated in response to changing cellular energy demands?

    • What signaling pathways directly influence cytochrome c oxidase function?

    • How do post-translational modifications integrate to form a "modification code" that regulates activity?

  • Species-Specific Adaptations:

    • What structural and functional adaptations enable Taterillus emini MT-CO2 to function optimally in its specific ecological niche?

    • How do these adaptations compare with other rodent species living in different environments?

    • Can these adaptations inform the development of more robust enzyme variants for biotechnological applications?

  • Assembly and Quality Control:

    • What chaperones and assembly factors are specific to the incorporation of MT-CO2 into the complete cytochrome c oxidase complex?

    • How are defective MT-CO2 proteins recognized and degraded?

    • What mechanisms prevent misfolded MT-CO2 from disrupting mitochondrial function?

  • Interaction with Cellular Systems:

    • How does MT-CO2 communicate with other components of mitochondrial and cellular metabolic networks?

    • What is the role of MT-CO2 in mitochondrial dynamics (fusion, fission, mitophagy)?

    • How does MT-CO2 contribute to retrograde signaling from mitochondria to the nucleus?

Addressing these questions will require multidisciplinary approaches combining structural biology, biochemistry, cell biology, and systems biology, ultimately leading to a more comprehensive understanding of this critical component of cellular energy metabolism .

How can researchers effectively integrate computational and experimental approaches in MT-CO2 studies?

Effective integration of computational and experimental approaches for studying Recombinant Taterillus emini MT-CO2 requires a systematic framework that leverages the strengths of both methodologies:

  • Iterative Model Refinement Workflow:

    • Start with computational predictions (AlphaFold, molecular dynamics)

    • Design targeted experiments to validate key structural features

    • Refine computational models based on experimental data

    • Generate new predictions for further experimental testing

  • Multi-scale Modeling Strategy:

    • Quantum mechanics calculations for active site chemistry and electron transfer

    • Molecular dynamics for protein dynamics and conformational changes

    • Systems biology modeling for integration with cellular metabolic networks

    • Each computational level generates hypotheses testable through different experimental approaches

  • Data Integration Framework:

    • Develop centralized databases combining:

      • Structural data (X-ray, Cryo-EM, NMR)

      • Functional measurements (enzyme kinetics, respirometry)

      • Proteomic data (interactome, post-translational modifications)

      • Evolutionary information (sequence conservation, phylogenetics)

    • Implement machine learning approaches to identify patterns across diverse datasets

  • Collaborative Research Platforms:

    • Establish shared resources including:

      • Standardized protocols for expression and purification

      • Common data formats and analysis pipelines

      • Repositories for mutant constructs and cell lines

      • Virtual collaboration tools for geographically distributed teams

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.