Recombinant Taurulus bubalis Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Taurulus bubalis Rhodopsin (rho) is a recombinant protein produced through heterologous expression systems. Key attributes include:

CharacteristicDetail
SpeciesTaurulus bubalis (Long-spined sea scorpion)
UniProt IDO42466
Gene Namerho
Expression Region1–287 amino acids
Molecular WeightNot explicitly provided (estimated ~30–35 kDa based on sequence length)
Storage-20°C (stable for extended periods); avoid repeated freeze-thaw cycles

The protein belongs to the opsins subfamily of GPCRs, specifically the rhodopsin-like receptors. Its primary role involves light sensing, though specific physiological functions in T. bubalis remain understudied .

Domain Organization

DomainPositionFunction
N-Terminal1–34Potential glycosylation sites (though not confirmed for T. bubalis)
TM135–61Transmembrane helix; critical for receptor stability
ICL162–80Intracellular loop; modulates G-protein coupling
TM281–100Second transmembrane domain; contributes to ligand binding pocket
ECL1101–110Extracellular loop; stabilizes retinal binding (if applicable)
TM3111–130Third transmembrane domain; forms part of the retinal-binding cavity
ICL2131–150Intracellular loop; interacts with downstream signaling partners
ECL2151–170Extracellular loop; may influence ligand specificity
TM4–TM7171–287Remaining transmembrane domains; form the core of the 7TM structure
H8288–287C-terminal helix; stabilizes the inactive state

Note: TM = Transmembrane; ICL = Intracellular Loop; ECL = Extracellular Loop; H8 = Helix 8.

Production and Applications

Recombinant Taurulus bubalis Rhodopsin is synthesized using bacterial or mammalian expression systems. Key production details:

ParameterSpecification
Tag TypeDetermined during production (e.g., His-tag, GST-tag)
PurityHigh (>90% as per chromatographic analysis, inferred from product specs)
Storage BufferTris-based buffer with 50% glycerol
Applications- Structural biology studies
- ELISA assays
- GPCR signaling research

The protein is often used in studies to explore conserved mechanisms of rhodopsin activation, though direct functional data on Taurulus bubalis remains limited .

Research Insights

While Taurulus bubalis rhodopsin has not been extensively studied, genomic and structural analyses provide indirect insights:

Genomic Context

The Taurulus bubalis genome assembly (615 Mb, 21 chromosomes) includes the rho gene, suggesting evolutionary conservation in opsins . Comparative studies with other rhodopsins (e.g., human, bovine) highlight potential similarities in retinal-binding mechanisms, though ligand specificity may differ .

Functional Hypotheses

  1. Light Sensing: Likely functions as a photopigment, though activation pathways (e.g., G-protein coupling) remain uncharacterized .

  2. Stability: Absence of glycosylation at N2 (unlike human rhodopsin) may influence protein trafficking or degradation .

Comparative Analysis

FeatureTaurulus bubalis RhodopsinHuman RhodopsinBovine Rhodopsin
Glycosylation SitesNot confirmed N2, N15 N2, N15
Thermal StabilityUnknownMonostableMonostable
Chromophore BindingRetinal? (Inferred)RetinalRetinal

Data gaps exist due to limited experimental studies on Taurulus bubalis rhodopsin.

Future Directions

  1. Structural Studies: X-ray crystallography to resolve 3D structure and retinal-binding modes .

  2. Functional Assays: Testing G-protein coupling and light-induced conformational changes.

  3. Comparative Genomics: Leveraging the Taurulus bubalis genome to identify paralogs or orthologs .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format requirement, kindly indicate it in your order notes and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Taurulus bubalis (Long-spined sea scorpion) (Cottus bubalis)
Target Names
rho
Target Protein Sequence
VNGAAYAGLCAYMFLLILVGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLGGF TTTMYTSAHGYFVLGRLGCNVEGFFATLGGEIALWSLVVLAVERWIVVCKPISNFRFTEE HAIMGLGFNWVMASACAVPPLVGWSRYIPEGMQCSCGINYYTRSEGFNNESLVMKMLICH FLIPLFVIFFCYGRMLCAVKEAAAAQQESETTQRAEREVSRMVVIMVISFLVCWLPYASV AWYIFCNQGSEFGPVFMTLPAFFAKSASIYNPLIYICMNKHSRHCMI
Uniprot No.

Target Background

Function
Rhodopsin, a photoreceptor, plays a crucial role in image-forming vision under low light conditions. While most saltwater fish species utilize retinal as the chromophore, freshwater fish primarily use 3-dehydroretinal, or a combination of retinal and 3-dehydroretinal. Upon light exposure, 11-cis retinal isomerizes to all-trans retinal, triggering a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation facilitates the displacement of the bound G-protein alpha subunit by arrestin, halting the signaling process.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Taurulus bubalis Rhodopsin and what is its significance in comparative visual studies?

Taurulus bubalis (long-spined sea scorpion) rhodopsin is a G-protein coupled receptor (GPCR) belonging to the Class A rhodopsin family of sensory receptors . The protein consists of 287 amino acids and functions as a visual pigment in the photoreceptor cells of this marine fish species .

The significance of studying T. bubalis rhodopsin lies in its value for comparative visual systems research. As a marine fish that has adapted to specific light environments, its rhodopsin may exhibit unique spectral tuning properties that inform our understanding of visual adaptation in aquatic environments. Comparative analysis with rhodopsins from other fish species provides insights into the molecular evolution of visual systems.

Methodologically, researchers typically approach comparative visual studies through:

  • Sequence analysis and comparison with rhodopsins from other species

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural modeling to identify key functional domains

  • Spectroscopic analysis to determine absorption maxima and biophysical properties

What expression systems are most effective for producing functional recombinant T. bubalis rhodopsin?

Several expression systems have proven effective for functional recombinant rhodopsin production, with the baculovirus/Sf9 insect cell expression system demonstrating particular success:

  • Baculovirus/Sf9 insect cell expression system:

    • Offers high expression levels (up to 4 mg/L after optimization)

    • Allows proper post-translational modifications

    • Enables proper protein folding and membrane insertion

    • Provides serum-free and protein-free growth medium options for large-scale bioreactor cultures

  • Mammalian cell lines (such as 293T cells):

    • Provide mammalian-type glycosylation patterns

    • Allow for studies in a cellular context similar to native environments

    • Have been successfully used for expression of cottoid fish blue opsins in experimental settings

Methodologically, researchers should:

  • Clone the full-length T. bubalis rhodopsin gene into an appropriate expression vector

  • Incorporate purification tags (e.g., hexahistidine) while ensuring they don't interfere with folding and function

  • Optimize expression conditions (temperature, induction time, media components)

  • Establish purification protocols typically involving detergent solubilization and immobilized-metal-affinity chromatography

  • Validate protein functionality through spectroscopic methods and G-protein activation assays

How can site-directed mutagenesis of T. bubalis rhodopsin be used to investigate spectral tuning mechanisms?

Site-directed mutagenesis is a powerful approach for investigating the molecular basis of spectral tuning in visual pigments like T. bubalis rhodopsin. The wavelength of maximum absorption (λmax) of visual pigments is determined by specific amino acid residues that interact with the chromophore.

Methodological approach:

  • Identify candidate amino acid positions for mutagenesis:

    • Based on sequence comparisons with rhodopsins of known λmax values

    • Using structural models to identify residues proximal to the retinal binding pocket

    • Focusing on positions that differ between species with different spectral sensitivities

  • Design mutagenesis strategy:

    • Create single-site mutations to assess individual contributions

    • Generate combinatorial mutations to evaluate synergistic effects

    • Introduce substitutions found in other species with different spectral properties

  • Express and purify mutant proteins:

    • Use established expression systems like 293T cells

    • Verify protein integrity by Western blotting

    • Ensure comparable expression levels across mutants

  • Reconstitute with 11-cis retinal:

    • Incubate purified opsin with 11-cis retinal under controlled conditions

    • Monitor reconstitution by absorbance spectroscopy

    • Calculate the percentage of properly folded and functional protein

  • Determine spectral properties:

    • Measure absorption spectra before and after photobleaching

    • Calculate difference spectra to precisely determine λmax values

    • Compare wild-type and mutant pigments under identical conditions

Research on cottoid fish has demonstrated that mutations at positions 118 (Thr to Gly), 215 (Pro to Gly), and 269 can significantly alter the spectral properties of blue cone opsins . Similar approaches can be applied to T. bubalis rhodopsin to understand its specific spectral tuning mechanisms.

What challenges exist in analyzing the phylogenetic relationships of T. bubalis rhodopsin with other fish visual pigments?

Phylogenetic analysis of fish visual pigments presents several methodological challenges that require careful consideration:

  • Sequence acquisition and quality:

    • Obtaining complete, error-free sequences is essential

    • The T. bubalis genome has been sequenced with 615 megabases in span, scaffolded into 21 chromosomal pseudomolecules , providing a reliable reference for rhodopsin gene identification

    • For comparative analysis, sequences from diverse fish lineages must be collected and vetted

  • Alignment methodological considerations:

    • Rhodopsin sequences contain conserved transmembrane domains and more variable loop regions

    • Alignment strategies should account for structural constraints

    • Gap placement in loop regions requires careful optimization

  • Phylogenetic model selection:

    • Different genes evolve at different rates; rhodopsin (RHO) has been used alongside other markers like 12S rDNA, 16S rDNA, COXI, CYB, and RAG1 for teleost phylogeny reconstruction

    • The super-distance matrix (SDM) approach can estimate the relative substitution rate among these genes

    • Model testing should be performed to select the most appropriate evolutionary model

  • Addressing adaptive evolution:

    • Visual pigments frequently undergo adaptive evolution in response to light environments

    • Standard phylogenetic methods may be confounded by convergent evolution

    • Specialized methods to detect selection should be incorporated

  • Calibration for molecular dating:

    • Establishing a temporal framework requires appropriate fossil calibration

    • A Bayesian relaxed molecular clock dating strategy can be employed

    • Selection of paleontological constraints is critical

Methodological approach:

  • Perform multiple sequence alignment with structure-aware algorithms

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods with appropriate substitution models

  • Test node stability through bootstrap resampling (typically 400+ replicates)

  • Map key functional substitutions onto the phylogeny to identify patterns of convergent evolution

How can functional assays be designed to compare T. bubalis rhodopsin with rhodopsins from other marine species?

Designing functional assays to compare rhodopsins across species requires standardized methodologies that allow for direct comparison of key functional parameters:

  • Spectral sensitivity characterization:

    • UV-Visible absorption spectroscopy to determine precise λmax values

    • Experimental design must include:

      • Identical protein:chromophore ratios across samples

      • Standardized detergent conditions

      • Temperature control during measurements

      • Multiple independent preparations to ensure reproducibility

    • Difference spectra (pre- vs. post-photobleaching) should be calculated to precisely determine λmax

  • G-protein activation assays:

    • GTPγS binding assays to measure activation kinetics

    • Implementation requirements:

      • Purified G-proteins (typically transducin)

      • Rhodopsin reconstituted in a consistent lipid environment

      • Precise light activation parameters

      • Standardized reaction conditions (temperature, buffer composition)

    • Kinetic parameters (initial rates, Vmax, EC50) should be determined for comparative analysis

  • Meta-state stability measurements:

    • Time-resolved spectroscopy to track photointermediates

    • Critical parameters:

      • Synchronized flash photolysis and detection

      • Consistent temperature conditions

      • Comparable protein concentrations

    • Analysis of meta-state decay rates provides insights into activation and deactivation kinetics

  • Thermal stability comparisons:

    • Fluorescence-based thermal shift assays

    • Differential scanning calorimetry

    • Implementation:

      • Identical buffer and detergent conditions

      • Standardized heating rates

      • Multiple technical replicates

    • Melting temperatures (Tm) provide a quantitative measure for stability comparisons

  • Experimental controls and standardization:

    • Include well-characterized reference rhodopsins (e.g., bovine rhodopsin)

    • Process all samples in parallel to minimize batch effects

    • Perform assays under conditions relevant to the species' natural environment

    • Include appropriate negative controls (e.g., opsin without chromophore)

By implementing these standardized functional assays, researchers can obtain quantitative comparisons of rhodopsin function across species, providing insights into adaptive evolution in different marine environments.

What are the optimal methods for purifying recombinant T. bubalis rhodopsin while maintaining its functional integrity?

Purification of functional recombinant rhodopsin requires careful attention to conditions that preserve native structure and chromophore interactions:

  • Extraction and solubilization:

    • Gentle detergent solubilization is critical

    • Recommended detergents:

      • n-Dodecyl β-D-maltoside (DDM)

      • Lauryl maltose neopentyl glycol (LMNG)

      • Digitonin for particularly sensitive applications

    • Implementation:

      • Use low detergent:protein ratios

      • Include stabilizing agents (glycerol, cholesterol)

      • Perform solubilization under dim red light to prevent photoactivation

      • Maintain low temperature (4°C) throughout

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni²⁺-agarose is effective for hexahistidine-tagged rhodopsin

    • Critical parameters:

      • Optimize imidazole concentration in wash buffers

      • Use gravity flow or low pressure systems to minimize shear forces

      • Include detergent in all buffers at concentrations above CMC

      • Consider using ligands during purification to stabilize structure

  • Size exclusion chromatography:

    • Final polishing step to ensure homogeneity

    • Implementation:

      • Use columns with appropriate resolution range

      • Monitor absorbance at both 280 nm (protein) and ~500 nm (chromophore)

      • Collect fractions with appropriate A280/A500 ratio

      • Verify monodispersity by dynamic light scattering

  • Buffer optimization:

    • Buffer composition significantly affects stability

    • Recommended components:

      • Tris or HEPES buffer (pH 7.0-7.4)

      • 100-200 mM NaCl

      • 10-20% glycerol

      • Protease inhibitors

    • Storage condition optimization:

      • Store at -20°C or -80°C for extended storage

      • Avoid repeated freeze-thaw cycles

      • Keep working aliquots at 4°C for up to one week

  • Quality control:

    • Assess purity by SDS-PAGE and Western blotting

    • Verify chromophore binding by UV-Visible spectroscopy

    • Confirm functionality through G-protein activation assays

    • Check thermal stability using fluorescence-based thermal shift assays

Following purification, recombinant rhodopsin can be reconstituted into a native lipid environment where it should be functionally indistinguishable from native rhodopsin with regard to spectral absorbance band, structural changes after photoactivation, and G-protein activation .

How can differential gene expression analysis help understand rhodopsin regulation in T. bubalis compared to other fish species?

Differential gene expression analysis provides valuable insights into the regulatory mechanisms controlling rhodopsin expression:

  • Experimental design considerations:

    • Tissue sampling strategy:

      • Collect retinal tissue at different developmental stages

      • Sample at different times during light/dark cycles

      • Compare expression in different photoreceptor populations

    • Environmental variables:

      • Manipulate light conditions to study light-dependent regulation

      • Investigate seasonal variations if applicable

      • Consider depth adaptation experiments for marine species

  • RNA extraction and quality control:

    • Preservation methods:

      • Flash freezing in liquid nitrogen

      • RNAlater for field collections

    • RNA integrity assessment:

      • Bioanalyzer analysis for RIN determination

      • Gel electrophoresis to verify intact rRNA bands

    • Contamination checks:

      • Spectrophotometric ratios (A260/A280, A260/A230)

      • PCR tests for genomic DNA contamination

  • Expression quantification methods:

    • RNA-Seq approach:

      • Library preparation optimized for retinal tissue

      • Sufficient sequencing depth (30-50 million reads per sample)

      • Appropriate bioinformatic pipeline for data analysis

    • qRT-PCR validation:

      • Design primers specific to T. bubalis rhodopsin

      • Select appropriate reference genes for normalization

      • Validate with standard curves and efficiency testing

  • Promoter analysis:

    • Identify the rhodopsin promoter region in the T. bubalis genome

      • The T. bubalis genome assembly spans 615 megabases , providing a resource for promoter identification

    • Compare with other fish species

      • Studies of goldfish have identified regulatory elements in green cone opsin promoters

      • An eight base pair motif conserved across species has been reported in the opsin gene promoter regions

    • Predicted transcription factor binding sites can be validated experimentally

  • Comparative analysis framework:

    • Expression level comparisons:

      • Studies in goldfish have shown differential expression of duplicate green opsin genes (green 2 expressed at higher levels than green 1)

      • Similar analysis can determine if T. bubalis shows specialized expression patterns

    • Regulatory network reconstruction:

      • Identify co-expressed genes

      • Infer transcription factor activities

      • Compare regulatory networks across species

This methodological approach allows researchers to understand species-specific adaptations in rhodopsin regulation and expression patterns, providing insights into visual system evolution and adaptation in different marine environments.

What techniques can be used to study post-translational modifications of T. bubalis rhodopsin and their functional significance?

Post-translational modifications (PTMs) play crucial roles in rhodopsin folding, trafficking, activation, and deactivation. Studying these modifications requires specialized techniques:

  • Identification of PTM sites:

    • Mass spectrometry-based approaches:

      • Bottom-up proteomics with enzymatic digestion

      • Top-down proteomics of intact protein

      • Implementation:

        • Use multiple proteases for comprehensive sequence coverage

        • Employ enrichment strategies for specific modifications

        • Apply complementary fragmentation methods (CID, ETD, HCD)

    • Site-specific antibodies:

      • Generation of antibodies against specific modifications

      • Implementation:

        • Design immunogens with the specific modification

        • Validate antibody specificity with positive and negative controls

        • Use for Western blotting and immunoprecipitation

  • Characterization of glycosylation:

    • N-linked glycosylation analysis:

      • PNGase F treatment followed by mass spectrometry

      • Lectin affinity chromatography

      • Implementation:

        • Compare mobility shifts on SDS-PAGE before and after deglycosylation

        • Analyze released glycans by HPLC or MS

        • Determine site occupancy and glycan heterogeneity

  • Phosphorylation studies:

    • Kinase identification:

      • In vitro kinase assays with recombinant GRK1/rhodopsin kinase

      • Inhibitor studies in cell culture systems

      • Implementation:

        • Generate phosphorylation-specific antibodies

        • Use phosphatase treatments as controls

        • Correlate with activation state

  • Functional significance assessment:

    • Site-directed mutagenesis:

      • Mutation of modification sites to non-modifiable residues

      • Introduction of phosphomimetic mutations

      • Implementation:

        • Express mutants in appropriate cell systems

        • Compare spectral properties and activation parameters

        • Analyze protein stability and trafficking

    • Time-resolved studies:

      • Monitor modification dynamics during photoactivation

      • Implementation:

        • Synchronize activation with flash photolysis

        • Quench reactions at defined timepoints

        • Analyze samples by Western blotting or MS

  • Structural impact analysis:

    • Molecular dynamics simulations:

      • Compare modified and unmodified protein dynamics

      • Implementation:

        • Build models with and without modifications

        • Analyze conformational changes and interaction networks

        • Identify potential allosteric effects

    • Spectroscopic analysis:

      • Circular dichroism to assess secondary structure changes

      • Fluorescence spectroscopy to monitor tertiary structure

These methodological approaches provide comprehensive insights into how post-translational modifications regulate T. bubalis rhodopsin function and how these mechanisms may differ from those in other species, reflecting environmental adaptations.

How does the genomic context of the rhodopsin gene in T. bubalis compare to other teleost fish, and what evolutionary insights can be gained?

Understanding the genomic context of the rhodopsin gene provides valuable insights into its evolution and regulation:

  • Genomic organization analysis:

    • The genome sequence of T. bubalis spans 615 megabases in 26 sequence scaffolds with a scaffold N50 of 29.1 Mb

    • The complete assembly sequence is assigned to 21 chromosomal-level scaffolds

    • Methodological approach:

      • Identify the rhodopsin gene locus in the genome assembly

      • Analyze intron-exon structure

      • Compare with other teleost genomes

      • Examine the presence of regulatory elements

  • Synteny analysis:

    • Examining conservation of gene order and neighbors:

      • Identify genes flanking rhodopsin in T. bubalis

      • Compare syntenic blocks across fish species

      • Implementation:

        • Use computational tools like SynFind or MCScanX

        • Visualize syntenic relationships with tools like Circos

        • Quantify syntenic conservation across evolutionary distances

  • Gene duplication analysis:

    • In contrast to T. bubalis, some teleosts like goldfish have duplicate opsin genes due to tetraploidy

    • Implementation:

      • Search for potential rhodopsin paralogs in the T. bubalis genome

      • Compare with the well-documented opsin duplications in goldfish

      • Analyze sequence divergence patterns of duplicated genes

      • Investigate potential subfunctionalization or neofunctionalization

  • Transposable element analysis:

    • Examining the influence of mobile genetic elements:

      • Identify transposable elements near the rhodopsin locus

      • Compare distributions across species

      • Implementation:

        • Use RepeatMasker and specialized TE detection tools

        • Analyze potential regulatory effects of proximal TEs

        • Investigate correlation with expression patterns

  • Evolutionary rate analysis:

    • Comparing selective pressures:

      • Calculate dN/dS ratios for rhodopsin across lineages

      • Identify sites under positive or purifying selection

      • Implementation:

        • Use PAML or HyPhy software packages

        • Apply branch-site models to detect lineage-specific selection

        • Correlate with ecological or environmental factors

The T. bubalis genome shows high completeness with a BUSCO v5.1.2 score of 98.4% (single 97.6%, duplicated 0.8%) using the actinopterygii_odb10 reference set , providing a robust foundation for these genomic analyses and evolutionary inferences.

What methods can be used to correlate T. bubalis rhodopsin properties with the species' visual ecology and habitat?

Understanding the relationship between rhodopsin properties and visual ecology requires integrating molecular data with ecological information:

  • Spectral environment characterization:

    • Field measurements of light spectra:

      • Measure downwelling and sidewelling light at various depths

      • Quantify seasonal and diurnal variations

      • Record turbidity and other optical properties

    • Implementation:

      • Use calibrated spectroradiometers

      • Sample across the species' depth range

      • Correlate with rhodopsin absorption spectra

  • Behavioral visual sensitivity testing:

    • Optomotor response assays:

      • Test visual responses to moving stimuli of different wavelengths

      • Quantify behavioral thresholds across the spectrum

    • Conditional training paradigms:

      • Train fish to respond to specific wavelengths

      • Determine discrimination thresholds

    • Implementation:

      • Design species-appropriate behavioral setups

      • Control for non-visual cues

      • Compare behavioral and molecular spectral sensitivity

  • Retinal anatomy and physiology:

    • Histological analysis:

      • Characterize photoreceptor distribution and density

      • Identify potential regional specializations

    • Electrophysiological recordings:

      • Electroretinography (ERG) to measure retinal responses

      • Single-cell recordings to characterize response properties

    • Implementation:

      • Use standardized histological techniques

      • Develop appropriate recording setups

      • Correlate with molecular expression patterns

  • Comparative approach:

    • Cross-species comparison:

      • Select phylogenetically diverse species from similar habitats

      • Include closely related species from different habitats

    • Methodological considerations:

      • Control for phylogenetic relationships

      • Standardize experimental conditions

      • Use statistical methods that account for shared ancestry

  • Molecular adaptation analysis:

    • Identify potential spectral tuning sites:

      • Compare with other cottoid fish rhodopsins

      • Focus on amino acid positions known to affect λmax

    • Site-directed mutagenesis:

      • Test the functional effects of substitutions

      • Compare with naturally occurring variations

    • Implementation:

      • Express mutant proteins in standardized systems

      • Measure spectral properties under identical conditions

      • Correlate shifts with specific environmental light conditions

This integrated approach connects molecular properties to ecological function, providing a comprehensive understanding of how T. bubalis rhodopsin has adapted to the species' specific visual environment.

How can cryo-electron microscopy be optimized for structural studies of T. bubalis rhodopsin?

Cryo-electron microscopy (cryo-EM) has become a powerful technique for membrane protein structural determination, including GPCRs like rhodopsin:

  • Sample preparation optimization:

    • Protein purification considerations:

      • Focus on homogeneity and stability

      • Select detergents compatible with cryo-EM (e.g., LMNG, GDN)

      • Consider reconstitution in nanodiscs or amphipols

    • Implementation:

      • Screen multiple constructs with different tags

      • Perform thermostability assays to identify optimal conditions

      • Use SEC-MALS to ensure monodispersity

  • Grid preparation optimization:

    • Critical parameters:

      • Grid type selection (gold vs. copper)

      • Glow discharge conditions

      • Blotting parameters (time, force, humidity)

      • Vitrification conditions

    • Implementation:

      • Use Quantifoil or C-flat grids with appropriate hole sizes

      • Test multiple freezing devices (Vitrobot, Leica EM GP2)

      • Optimize protein concentration (typically 2-5 mg/ml)

      • Consider additives to improve particle distribution

  • Data collection strategy:

    • Microscope settings:

      • Voltage (typically 300 kV for highest resolution)

      • Dose rate optimization

      • Exposure time and framing strategy

      • Defocus range selection

    • Implementation:

      • Use energy filters to improve signal-to-noise ratio

      • Implement beam-tilt correction for higher resolution

      • Collect movies rather than single exposures

      • Use automated data collection software for efficiency

  • Data processing workflow:

    • Motion correction:

      • Frame alignment using MotionCor2 or similar

      • Dose weighting to account for radiation damage

    • CTF estimation:

      • Use CTFFIND4 or Gctf for accurate determination

      • Apply per-particle CTF correction when possible

    • Particle picking and processing:

      • Use template-based or deep learning approaches

      • Implement 2D and 3D classification to improve homogeneity

      • Apply appropriate symmetry when warranted

    • Final refinement:

      • Use Bayesian approaches for resolution estimation

      • Apply masking and sharpening techniques

      • Validate using independent half-sets (gold-standard FSC)

  • Validation and interpretation:

    • Model building considerations:

      • Start with homology models based on existing rhodopsin structures

      • Use automated tools with manual inspection and correction

      • Validate geometry and fit to density

    • Functional validation:

      • Correlate structural features with spectroscopic data

      • Test predictions with mutagenesis experiments

      • Compare with structures in different conformational states

These methodological approaches can yield high-resolution structures of T. bubalis rhodopsin, providing insights into species-specific features and general principles of rhodopsin structure and function.

What computational methods are most effective for predicting T. bubalis rhodopsin interactions with G-proteins and other signaling partners?

Computational prediction of protein-protein interactions provides valuable insights that guide experimental studies:

  • Homology-based structure prediction:

    • Template selection:

      • Use existing structures of rhodopsin-G-protein complexes

      • Select templates with highest sequence identity to T. bubalis proteins

    • Model building:

      • Generate multiple models using software like Modeller or SWISS-MODEL

      • Evaluate models with DOPE scores, QMEAN, or ProCheck

      • Refine models with energy minimization

    • Implementation:

      • Generate ensemble of models to account for uncertainty

      • Focus refinement on interface regions

      • Validate with experimental crosslinking data when available

  • Protein-protein docking:

    • Rigid body docking:

      • Use programs like ZDOCK, HADDOCK, or ClusPro

      • Generate and score thousands of potential complexes

      • Cluster results to identify recurring binding modes

    • Flexible docking:

      • Account for conformational changes during binding

      • Use normal mode analysis or molecular dynamics refinement

      • Implement ensemble docking approaches

    • Implementation:

      • Incorporate experimental constraints when available

      • Use biological knowledge to filter solutions

      • Validate with mutagenesis data

  • Molecular dynamics simulations:

    • Complex stability assessment:

      • Run extended simulations (100+ ns) of predicted complexes

      • Analyze interface contacts and binding energy

      • Identify stable hydrogen bonds and salt bridges

    • Implementation:

      • Use explicit solvent models with physiological ion concentrations

      • Embed in realistic membrane environments

      • Apply enhanced sampling techniques to explore conformational space

  • Machine learning approaches:

    • Interface prediction:

      • Train neural networks on known GPCR-G protein interfaces

      • Predict binding sites based on sequence and structural features

      • Use evolutionary conservation as additional input

    • Implementation:

      • Employ deep learning architectures for feature extraction

      • Validate with cross-validation and independent test sets

      • Compare predictions with experimental data

  • Network-based approaches:

    • Pathway analysis:

      • Construct signaling networks based on known GPCR pathways

      • Identify potential pathway-specific adaptations in T. bubalis

      • Predict signal transduction outcomes

    • Implementation:

      • Integrate multiple data types (genomic, proteomic, etc.)

      • Use Bayesian networks or Boolean models for predictions

      • Validate with targeted experiments

These computational approaches provide testable hypotheses about T. bubalis rhodopsin interactions with signaling partners, guiding experimental design and helping interpret experimental results in a systematic framework.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.